KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090193: AU37_19520Help
Entry
AU37_19520        CDS       T03732                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
seno  Salmonella enterica subsp. enterica serovar Enteritidis EC20090193
Pathway
seno00071  Fatty acid degradation
seno00280  Valine, leucine and isoleucine degradation
seno00281  Geraniol degradation
seno00310  Lysine degradation
seno00362  Benzoate degradation
seno00380  Tryptophan metabolism
seno00410  beta-Alanine metabolism
seno00640  Propanoate metabolism
seno00650  Butanoate metabolism
seno00903  Limonene and pinene degradation
seno00930  Caprolactam degradation
seno01100  Metabolic pathways
seno01110  Biosynthesis of secondary metabolites
seno01120  Microbial metabolism in diverse environments
seno01130  Biosynthesis of antibiotics
seno01200  Carbon metabolism
seno01212  Fatty acid metabolism
Module
seno_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:seno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AU37_19520 (fadB)
   00650 Butanoate metabolism
    AU37_19520 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AU37_19520 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AU37_19520 (fadB)
   00310 Lysine degradation
    AU37_19520 (fadB)
   00380 Tryptophan metabolism
    AU37_19520 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AU37_19520 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AU37_19520 (fadB)
   00281 Geraniol degradation
    AU37_19520 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AU37_19520 (fadB)
   00930 Caprolactam degradation
    AU37_19520 (fadB)
Enzymes [BR:seno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AU37_19520 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AU37_19520 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AU37_19520 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     AU37_19520 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AHP76076
LinkDB All DBs
Position
complement(4058148..4060337)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGQALEVLEKQHDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHALK
IGLVDGVVKQEKLIEGAIAVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGMV
AQTAGKHYPAPMTAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDIETPKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRP
ETVLASNTSTIPIGELASALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKEYRDAIDALFDASRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVDDLLASVSQTKRDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTQGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPA
RPVGSLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttataaaggcgacaccctgtacctcgactggctggaagatggcatcgccgaactg
gtgttcgatgctccaggctcggtcaataaactcgacaccgcaaccgtcgccagcctcggc
caggcgcttgaggtgctggaaaagcaacacgatttaaaagggctgctgctgcgctctaat
aaagcggcctttattgtcggcgcggacatcaccgaatttctttcactgttcctcgtcccc
gaagagcagttaagccaatggctgcatttcgctaatagcgtctttaaccgtctggaagat
ttacccgtaccgacccttgccgccgtaaacggctatgcgttgggcggcgggtgcgaatgc
gtgctggccaccgattaccgtctggcgacgccagacctccgtatcggtctgccggaaact
aaactgggcatcatgccgggtttcggcggctccgttcgtctgccgcgtatgctgggcgca
gacagcgcgctggagattatcgcggcaggtaaagatgtcggtgctgagcacgcgctgaaa
atcggccttgtggacggcgtggtcaaacaagagaagctaattgaaggcgcgatagcggtg
ttacgccaggccattaccggcgatctcgactggagagctaaacgccagccgaaactggaa
ccgttgaaactcagtaagattgaagcggcgatgagctttaccatcgctaaaggcatggtc
gcacaaacggcgggtaaacattatccggcgccgatgaccgcagtgaaaaccattgaagcc
gccgcgcgttttggtcgtgaagaagcgctgaatctggaaaataaaagctttgttccgctg
gcgcataccaatgaggctcgtgcgctggtcggtatcttcctcaacgatcaatatgtaaaa
ggtaaagccaaaaagctgaccaaagatattgagacgccgaaacaggcagccgtactgggc
gcgggcattatgggcggcggtatcgcttaccagtcggcctggaaaggcgtaccggtcatc
atgaaagatatcaacgataaatcgttgaacctcggcatgaccgaagcggccaagctgctg
aacaaacagctggagcgcggcaagatcgacggtctgaagctggcgggcgtcatttcgacc
atccacccgactctcgattatgccggtttcgatcgcgtagatgttgttgtcgaagcggta
gtcgaaaatccgaaagtgaaaaaagcggtactggcggaaaccgagcagaaagtgcgcccg
gaaaccgtgctggcctcaaatacctccaccatcccaattggcgaactggcaagcgccctg
gaacgtccggaaaacttttgcggaatgcacttcttcaacccggtacaccggatgccgctg
gttgaaatcattcgcggcgagaagagttcagacgaaaccattgccaaagtcgtcgcctgg
gccagcaaaatgggcaagacgccgattgtagtcaacgactgccccggcttctttgttaac
cgcgtgctgttcccctatttcgccggtttcagtcaactgctgcgcgacggcgcggatttc
cgcaaagtcgataaagtgatggaaaaacagttcggctggccgatgggcccggcctatctg
ctcgacgtggtgggtattgataccgcccaccacgcgcaggcggtaatggcggcaggcttc
ccacaacggatgcagaaagagtatcgcgacgcgatcgacgcattgtttgacgccagccgt
tttgggcaaaaaaacggtctgggcttctggcgctataaagaagacagcaagggtaagccg
aagaaagaagaagatgctgcggtggatgacctgctggcaagcgtcagtcagacgaaacgc
gacttcagcgacgacgagataatcgcccgtatgatgatcccgatgattaacgaagtggtt
cgctgtctggaagaaggcattatcgcaagcccggcggaagccgatatggcgctggtctac
ggcctgggcttccctccgttccacggcggcgcattccgctggctggatacacagggcagc
gcgaaatatcttgatatggcgcagcagtatcaacacctcggcccgctgtatgaagtgccg
gaagggctgcgtaataaagcgcgccataacgaaccgtattatcccccggttgaaccagcc
cgtccggttggttctctgaaaacggcttaa

DBGET integrated database retrieval system