KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090193: AU37_19730Help
Entry
AU37_19730        CDS       T03732                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
seno  Salmonella enterica subsp. enterica serovar Enteritidis EC20090193
Brite
KEGG Orthology (KO) [BR:seno00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    AU37_19730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: AHP76112
LinkDB All DBs
Position
4106133..4107005
Genome map
AA seq 290 aa AA seqDB search
MLKTVHQKAGRHTRPVRAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAA
FPMFSDVSIQLRHFIFANFMPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAI
DSALNTIWRSKRTRPKVYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV
LRILPLLLSWISFWLLYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQL
IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEADQP
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaaccgttcaccaaaaagctggacgccatacgcgccctgttcgggcctggctc
aagctattatggcagcgtatcgatgaggataatatgacgactctggcgggaaatctcgct
tatgtctcattactctccttagtaccgcttattgccgtcgtttttgcccttttcgctgct
tttccgatgttttctgatgtcagcattcagttacgccattttatttttgctaactttatg
ccagccaccggagacgtgattcagcgctatattgagcagtttgtcgctaactccaacaaa
atgacggcggtgggtgcctgtggactgattgtgacggcattgctgttgatgtacgccatt
gatagcgccttaaacactatctggcgcagcaaacgcacacggccaaaagtgtactctttt
gcggtgtactggatgatcctcacgctcggcccgcttctcgccggtgccagcctggcgatc
agctcctacctgctttctttacgctgggccagcgatctgaatacggtcatcgacaatgta
ttgcgcatccttccgctgctgctctcgtggatctcattctggttactttacagtattgtc
ccaacaactcgcgtaccgaaccgtgacgcccttgtcggcgcgtttgtcgcagcgttgctg
ttcgaggccggaaagaaaggtttcgcgctttatatcaccatgttcccgtcatatcagctc
atttatggcgtactggcagtgatccctatcctgtttgtctgggtatactggacctggtgt
atagtcttgcttggcgcagaaataactgtcactctcggggaataccgaaaactcaaacaa
gccgcagaacaagaagaagctgaccaaccatga

DBGET integrated database retrieval system