KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090531: AU40_16730Help
Entry
AU40_16730        CDS       T03761                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
senq  Salmonella enterica subsp. enterica serovar Enteritidis EC20090531
Pathway
senq00030  Pentose phosphate pathway
senq01100  Metabolic pathways
senq01110  Biosynthesis of secondary metabolites
senq01120  Microbial metabolism in diverse environments
senq01130  Biosynthesis of antibiotics
senq01200  Carbon metabolism
senq01230  Biosynthesis of amino acids
Module
senq_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
senq_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:senq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AU40_16730
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    AU40_16730
Enzymes [BR:senq01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     AU40_16730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AHR20486
LinkDB All DBs
Position
complement(3124384..3126375)
Genome map
AA seq 663 aa AA seqDB search
MSSRKELANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWRDFLNHNPTNPSWADRDRF
VLSNGHGSMLIYSLLHLTGYDLPMSELQNFRQLHSKTPGHPEVGYTAGVETTTGPLGQGI
ANAVGMAIAEKTLAAQFNRPGHDIVDHFTYVFMGDGCMMEGISHEVCSLAGTLKLGKLIA
FYDDNGISIDGHVEGWFTDDTAKRFEAYGWHVIRGIDGHDADAIKRATEEARAVTDKPSL
LMCKTIIGFGSPNKQGTHDSHGAPLGDAEIALTREQLGWKYAPFEIPSEIYAQWDAKEAG
QAKESAWNEKFAAYEKAFPQEAAEFTRRMKGDMPADFDAKANEFIAKLQANPSKIASRKA
SQNAIEAFGPLLPEFLGGSADLAPSNLTLWSGSKAINEDAAGNYIHYGVREFGMTAIANG
IALHGGFLPYTSTFLMFVEYARNAVRMAALMKQRQVMVYTHDSIGLGEDGPTHQPVEQVA
SLRVTPNMSTWRPCDQVESAVAWKYGVERQDGPTALILSRQNLAQQERTEEQLANIARGG
YVLKDCAGQPQIIFIATGSEVELAVAAYEKLTAEGVKARVVSMPSTDAFDKQDAAYRESV
LPKDVSARVAIEAGIADYWFKYVGLNGAIVGMTTFGESAPAELLFEEFGFTVDNVIAKAK
ALL
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcacgtaaagagcttgccaatgctattcgtgcgctgagcatggacgcagtacag
aaagccaaatccggtcacccgggtgccccgatgggtatggctgacattgccgaagtcctg
tggcgtgatttcctgaaccacaacccgaccaacccgtcctgggccgaccgcgaccgcttc
gtgctgtccaatggccacggctcaatgctgatttacagcctgctgcacctcaccggttat
gacctgccgatgtccgagctgcagaatttccgtcagctacattcaaaaacccctggtcac
ccggaagtgggctacaccgctggcgttgaaaccactactggcccgctgggtcagggtatt
gccaacgccgtcgggatggcgattgccgagaaaactctggcggcgcagtttaatcgtcct
ggccacgatatcgttgaccacttcacctacgtctttatgggcgacggctgcatgatggaa
ggcatttctcacgaagtgtgctctctggctggtactctgaaactgggcaaactgatcgcg
ttctatgatgacaacggtatctctatcgatggtcatgttgaaggctggttcaccgatgac
accgcgaaacgttttgaagcctacggctggcacgttatccgtggcattgacggtcacgat
gccgacgccattaaacgcgccacggaagaagctcgcgccgtgactgacaaaccgtccctg
ctgatgtgcaaaaccatcatcggtttcggttcgccgaacaaacagggtacccacgattcc
cacggcgcgccgctgggcgacgcggaaatcgcgctgacccgcgaacagttgggctggaaa
tacgcgccgttcgaaatcccgtctgaaatctacgcccagtgggatgcgaaagaagccggc
caggcgaaagaatccgcatggaatgagaaattcgcggcttatgagaaagccttcccgcag
gaagctgctgaattcactcgtcgtatgaaaggcgacatgccggctgacttcgatgcgaaa
gcgaatgagttcatcgctaaactgcaggcgaatccatccaaaatcgccagccgtaaagcg
tcccagaatgccatcgaagccttcggtccgctgttgccggaattcctcggcggctccgct
gacctggcaccttctaacctgaccctgtggtccggttcgaaagcgattaacgaagatgcc
gcaggtaactacattcattacggtgtgcgcgaattcggtatgaccgctatcgccaacggt
atcgccctgcacggcggtttcctgccgtacacctccaccttcctgatgttcgtcgaatat
gcccgtaacgcagtgcgtatggcagcgttgatgaaacagcgtcaggtgatggtctatacc
cacgactccatcggtctgggcgaagatggcccgacgcaccagccggtcgagcaggtggca
agcctgcgcgtaacgccgaacatgtccacatggcgtccgtgcgaccaggtggaatccgcg
gtggcgtggaaatatggcgtagagcgtcaggatggcccaaccgcgctgatcctctcccgt
cagaacctggcgcagcaggaacgtactgaagagcaactggcgaatatcgcccgcggtggt
tacgtactgaaagattgtgcgggccagccgcagattatcttcattgcgaccggttcagag
gttgagctggcggttgccgcttacgaaaaactaactgccgaaggcgtgaaggcgcgcgtg
gtttccatgccgtctaccgacgcattcgacaagcaggatgcggcttaccgtgaatccgtg
ctgccgaaggacgtctctgcgcgtgtagcgattgaagcgggtatcgctgactactggttc
aaatacgtcggcctgaacggcgctattgtcgggatgaccaccttcggtgaatccgccccg
gcagagctgttgtttgaagagtttggcttcacggtggacaacgtgatcgccaaagcgaaa
gcactgctgtaa

DBGET integrated database retrieval system