KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090531: AU40_17770
Entry
AU40_17770        CDS       T03761                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
senq  Salmonella enterica subsp. enterica serovar Enteritidis EC20090531
Pathway
senq00052  Galactose metabolism
senq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AU40_17770
Enzymes [BR:senq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     AU40_17770
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Methyltransf_25 MTS ADH_zinc_N_2 2-Hacid_dh_C TrkA_N Methyltransf_31 Methyltransf_11 3HCDH_N PrmA Shikimate_DH UDPG_MGDP_dh_N Met_10 Pyr_redox_2 Sacchrp_dh_NADP Methyltransf_24 CoA_binding ELFV_dehydrog Pyr_redox FAD_binding_2
Other DBs
NCBI-ProteinID: AHR20659
LinkDB
Position
3312346..3313389
AA seq 347 aa
MKSVVIHAEGDVRVEERPLPQLQAEDDVLVKVVSSGLCGSDIPRIFAQGAHYYPITLGHE
FSGYVESYGTGVTDMQPGDAVACVPLLPCFRCPQCERGYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPSDMPIEDGAFIEPITVGLHAFHLAQGCEGKNVIIVGAGTIGLLALQCA
RELGARSVTAIDINPQKLELAKALGATHTCNSREMTADDIQTALSDIQFDQLVLETAGTP
QTVSLAIDIAGPRAQLALVGTLHHDLTLTTRTFGLILRKELTLLGSWMNYSAPWPGEEWE
TAARLLAEKRLQLTPLIAHRGDAESFAEAVKALNGAPMQGKILLQLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggttattcacgctgagggagacgtgcgcgttgaagaacgtcccttacca
caactgcaagccgaggacgatgtgttggtcaaagtcgttagctcagggctttgcgggtcg
gatatcccgcgtattttcgcgcagggcgcccattattatcctattacgttaggccatgaa
ttcagcggctacgttgaatcctacggcacaggcgtaacggatatgcagcctggcgatgcc
gtcgcttgtgtcccgcttcttccctgctttcgctgtccgcaatgcgaacgcggttacttt
tctttatgcaaacagtatcagtttgtaggatcgcgcagcgaaggcggtaatgcggaatat
gtggtggtcaaacgggccaatcttttccgcttgccgtctgatatgccgattgaagatggc
gcgtttatcgaaccaattaccgtgggcttacacgcctttcatctggcgcagggctgcgag
gggaaaaacgtaattatcgttggtgccgggacaattggcctgctggccttacagtgcgcg
cgggaactgggcgcgcgaagcgtaacggcgattgatatcaatccgcagaaactggaactt
gcgaaagcgctcggcgcaacgcatacctgtaatagccgggaaatgaccgccgacgacatc
cagaccgcgttgtccgacattcagtttgatcaactggttctcgaaacggcaggaactccc
cagaccgtctcgctggctatcgatatcgccgggccgcgcgcgcaactggcgctggtgggg
acgttacatcacgatctcaccctgacaacgcgtacattcgggctaattttgcgtaaagag
ctcacgctcctcggcagttggatgaactactccgcgccatggccaggagaagaatgggaa
accgcagcgcgcctgttggctgaaaaacgtcttcaactgacccctctcattgcccatcgc
ggcgatgcggaaagctttgcagaagcagtcaaagcgcttaatggcgcgcccatgcagggc
aaaatcctacttcaactttcctga

DBGET integrated database retrieval system