KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090531: AU40_19050Help
Entry
AU40_19050        CDS       T03761                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
senq  Salmonella enterica subsp. enterica serovar Enteritidis EC20090531
Pathway
senq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
senq01100  Metabolic pathways
senq01110  Biosynthesis of secondary metabolites
senq01130  Biosynthesis of antibiotics
senq01230  Biosynthesis of amino acids
Module
senq_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:senq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AU40_19050 (aroK)
Enzymes [BR:senq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     AU40_19050 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK AAA AAA_16 APS_kinase TsaE AAA_22 ABC_tran AAA_7 AAA_17 AAA_5 Ploopntkinase3 RNA_helicase AAA_PrkA AAA_25 AAA_28 AAA_29 RsgA_GTPase His_biosynth PduV-EutP Mg_chelatase AAA_2 AAA_24 IstB_IS21 AAA_14
Motif
Other DBs
NCBI-ProteinID: AHR20876
LinkDB All DBs
Position
complement(3522977..3523498)
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDVEGEDGFR
NREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVEAPPREVLEALANERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggaaaaagcactatt
gggcgccagttagctcaacaactcaatatggaattttacgattctgatcaagagattgag
aaacgaaccggagctgatgtgggctgggtcttcgatgttgaaggtgaagacggcttccgt
aatcgtgaagaaaaagttatcaacgaattgacggaaaaacagggtattgtgctggcaacc
ggcggtggctctgtaaaatcgcgtgaaacgcgtaaccgtctctccgcgcgtggcgtcgtg
gtctaccttgaaacgaccatcgaaaaacaactggcgcgcacgcagcgtgataaaaaacgc
ccgctgttgcaggttgaagcaccgcctcgcgaagttctggaagcgctggctaacgaacgc
aatccgctgtacgaagagattgccgacgtcaccattcgcaccgacgatcaaagcgctaag
gttgtggcaaaccagattattcatatgctggaaagcaactaa

DBGET integrated database retrieval system