KEGG   Salmonella enterica subsp. enterica serovar Typhimurium DT2: STMDT2_04831Help
Entry
STMDT2_04831      CDS       T02869                                 

Gene name
htpG
Definition
(GenBank) heat shock protein HtpG
  KO
K04079  molecular chaperone HtpG
Organism
senr  Salmonella enterica subsp. enterica serovar Typhimurium DT2
Brite
KEGG Orthology (KO) [BR:senr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:senr01009]
    STMDT2_04831 (htpG)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:senr03110]
    STMDT2_04831 (htpG)
   04131 Membrane trafficking [BR:senr04131]
    STMDT2_04831 (htpG)
   03051 Proteasome [BR:senr03051]
    STMDT2_04831 (htpG)
   03029 Mitochondrial biogenesis [BR:senr03029]
    STMDT2_04831 (htpG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:senr04147]
    STMDT2_04831 (htpG)
Protein phosphatases and associated proteins [BR:senr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     STMDT2_04831 (htpG)
Chaperones and folding catalysts [BR:senr03110]
 Heat shock proteins
  HSP90
   STMDT2_04831 (htpG)
Membrane trafficking [BR:senr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    STMDT2_04831 (htpG)
Proteasome [BR:senr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    STMDT2_04831 (htpG)
Mitochondrial biogenesis [BR:senr03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    STMDT2_04831 (htpG)
Exosome [BR:senr04147]
 Exosomal proteins
  Proteins found in most exosomes
   STMDT2_04831 (htpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP90 HATPase_c_3 HATPase_c HP0268 PE Apolipoprotein
Motif
Other DBs
NCBI-ProteinID: CDG06641
LinkDB All DBs
Position
543910..545784
Genome map
AA seq 624 aa AA seqDB search
MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADKLRFRALSNPDLYEGD
GELRVRVSFDKDKRTLTIADNGVGMNRDEVIDHLGTIAKSGTKSFLESMGSDQAKDSQLI
GQFGVGFYSAFIVADKVTVRTRAAGDKPENGVFWESAGEGEYTVADITKNDRGTEITLHL
REGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDGETVISWEKINKAQALWTRNKSE
IKDDEYNEFYKHIAHDFTDPLTWSHNRVEGKQEYTSLLYIPSQAPWDLWNRDHKHGLKLY
VQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPLNVSREILQDSTVTRNLRSALTKRVLQML
EKLAKDDAEKYQTFWKQFGLVLKEGPAEDHANQEAIAKLLRFASTHTDSSAQTVSLEDYV
SRMKEGQEKIYYITADSYAAAKNSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKAF
QSVAKADESIEKLADEVDENAKEAEKALEPFVERVKTLLGDRVKDVRLTHRLTDTPAIVT
TDADEMSTQMAKLFAAAGQSVPEVKYIFELNPDHVLVKRTADTKDEAQFKEWVELLLDQA
LFAERGTLEDPNQFIRRMNQLLVS
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggacaagaaacgcgtggttttcagtcagaagttaaacagcttctgcacctgatg
atccattctctttattccaataaagaaatcttcctgcgtgaactcatctctaacgcctca
gatgcggcggacaagctgcgtttccgcgctctgtcaaacccggatctgtatgaaggagat
ggcgagctgcgtgtgcgcgtctctttcgataaagataagcgtacgttgaccattgccgat
aacggcgtggggatgaatcgtgatgaggtgattgaccacttaggcaccattgccaagtcc
ggcaccaaatctttcctcgaatcaatggggtccgatcaggcgaaagatagccagctcatc
ggtcagtttggcgtaggcttctactccgcgtttattgtggccgataaagtgaccgtacgt
actcgtgcggcaggcgacaagccggaaaatggcgtgttctgggaatcggcaggcgaaggc
gaatacaccgttgccgatatcaccaaaaatgaccgtggtacggaaatcaccttacacctg
cgtgaaggcgaagatgaattcctcgatgactggcgcgtacgctcgattatcagcaaatat
tccgatcacatcgcattgccggtagagattgaaaaacgggaagaaaaagacggcgaaacc
gtgatttcctgggagaaaatcaacaaggcccaggcgttgtggacccgtaacaagtcggaa
attaaagacgacgagtacaacgagttttacaagcacatcgcgcatgatttcaccgatccg
ctgacctggagccacaaccgcgtggaaggtaagcaggagtacaccagcctgctgtatatc
ccgtcgcaggcgccgtgggatctgtggaaccgcgatcacaaacatggtctgaagctgtac
gtacagcgcgtgttcattatggacgatgccgagcagttcatgccgaactatctgcgtttc
gtgcgcggcctgattgattctaatgacctgccgttgaacgtctcccgtgaaatcctgcag
gacagcacggtaacgcgtaatctgcgtagcgctctgaccaaacgcgtcctgcaaatgctg
gaaaaactggcgaaagacgacgcggaaaaataccaaaccttctggaaacagttcggtctg
gtgctgaaagaaggcccggcggaagatcacgccaaccaggaagcgatcgctaaactgttg
cgctttgcctccacccataccgactcttccgcccagaccgtgtcgctggaagattacgtc
tcccggatgaaagaagggcaggaaaaaatctactacatcaccgcagacagctatgcggcg
gcgaaaaacagcccgcacctggaactgctgcgtaagaaaggcatcgaagtgctgctgctc
tccgatcgcatcgacgagtggatgatgaactacctgaccgagtttgacggtaaagcattc
cagtcggtcgctaaagccgatgaatccatcgaaaaactggcggatgaagtcgacgaaaac
gcgaaagaagcggaaaaggcgcttgagccgtttgtggagcgtgtcaaaaccctgctgggc
gatcgcgtgaaagacgtgcgtctgacgcaccgtttaaccgacacgccggcgattgtcacc
accgatgcggatgaaatgagcacccagatggcgaaactgttcgccgcggctggtcagtcc
gtgccggaagtgaaatacatctttgagctcaacccggatcatgtgctggttaaacgcact
gccgataccaaggatgaagcgcagtttaaagagtgggttgagctgctgctggatcaggcg
ctgttcgctgaacgcggtacgctggaagatccgaaccagtttatccgccgtatgaaccag
ttgctggtgtcctga

DBGET integrated database retrieval system