KEGG   Salmonella enterica subsp. enterica serovar Typhimurium DT2: STMDT2_23581Help
Entry
STMDT2_23581      CDS       T02869                                 

Definition
(GenBank) putative 3-ketoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
senr  Salmonella enterica subsp. enterica serovar Typhimurium DT2
Pathway
senr00071  Fatty acid degradation
senr00280  Valine, leucine and isoleucine degradation
senr00281  Geraniol degradation
senr00362  Benzoate degradation
senr00592  alpha-Linolenic acid metabolism
senr01100  Metabolic pathways
senr01110  Biosynthesis of secondary metabolites
senr01120  Microbial metabolism in diverse environments
senr01130  Biosynthesis of antibiotics
senr01212  Fatty acid metabolism
Module
senr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:senr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STMDT2_23581
   00592 alpha-Linolenic acid metabolism
    STMDT2_23581
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STMDT2_23581
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    STMDT2_23581
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STMDT2_23581
   00642 Ethylbenzene degradation
    STMDT2_23581
Enzymes [BR:senr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     STMDT2_23581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CDG08514
LinkDB All DBs
Position
complement(2490853..2492163)
Genome map
AA seq 436 aa AA seqDB search
MRQALPLVTRQGDRIAIVSGLRTPFARQATAFHGIPAVDLGKMVVGELLARSEIPADAIE
QLVFGQVVQMPEAPNIAREIVLGTGMNVHTDAYSVSRACATSFQAVANVAESLMAGTIRA
GIAGGADSSSVLPIGVSKALARVLVDVNKARTTRQRLTLFSRLRLRDLLPVPPAVAEYST
GLRMGDTAEQMAKTYGITREQQDALAHRSHQRAAQAWAEGKLAEEVMTTYVPPYKNPFAE
DNNIRGASTLADYAKLRPAFDRKHGSVTAANSTPLTDGAAAVILMTESRAKELGLRPLGY
LRSYAFTAIDVWQDMLLGPAWSTPLALERAGLTMADLTLFDMHEAFAAQTLANLQLLGSE
RFAREVLGCAQATGEVDDAKFNVLGGSIAYGHPFAATGARMITQTLHELRRRGGGFGLVT
ACAAGGLGAAMVLEAE
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaggctttaccgttggtcacccgccagggcgatcgcattgctattgtcagtggg
ttacgaacccccttcgctcgtcaggccactgcatttcatggtattcccgctgttgatctc
ggcaagatggtggtaggcgagctgctggcgcgcagtgaaattccagccgatgccattgag
caactggtttttggtcaggtagtacaaatgccggaagcccccaatattgcgcgcgaaatt
gtgctgggtacggggatgaatgttcataccgatgcctatagcgtaagccgcgcctgcgcc
accagttttcaggcggtagcgaatgtggcggaaagcctgatggccggcacgatacgcgcc
ggtatcgctggcggcgcagattcgtcgtcggtactgccaataggcgtgagtaaagccctg
gcgcgggtactggttgatgtcaataaagcccggacgacccgccaacggctgacgcttttt
tctcgtctgcgcttacgcgacctgctgcccgttcctcccgccgttgctgagtattccacc
ggtctgcgcatgggcgataccgccgaacagatggcgaaaacgtatggtattacgcgtgaa
cagcaggacgcgctggcgcatcgttcacatcagcgcgccgcgcaggcatgggcggagggc
aaactggcggaagaagtgatgacgacctatgtgccgccgtataaaaacccctttgcagaa
gacaacaacattcgcggcgcctccacgctggcggactacgctaaactgcgtcccgctttt
gaccgaaaacatggctccgtaaccgccgccaacagtacaccgctgaccgacggcgctgcc
gccgttattctgatgaccgaatcccgcgctaaagagctggggctgcgcccgcttggttat
ctgcgcagctacgcctttaccgctattgatgtctggcaggacatgctattggggccggcc
tggtcaacgccgctggcgctggagcgggccgggttgacgatggccgatctgacgcttttt
gacatgcatgaagcgtttgccgctcagactctggcgaacttacaactgctgggcagcgaa
cgatttgcccgtgaggtgcttggttgtgcgcaggcgacaggggaggtggatgacgctaaa
ttcaacgtgctcggcggctcaatcgcctacgggcatccttttgccgcaacgggcgcgcgg
atgataacccaaacgttgcatgaattacggcgtcggggcggaggttttggcctggtcacg
gcctgcgcggctggcggtcttggcgcggcgatggttctggaggcggaataa

DBGET integrated database retrieval system