KEGG   Salmonella enterica subsp. enterica serovar Typhimurium DT2: STMDT2_31271Help
Entry
STMDT2_31271      CDS       T02869                                 

Definition
(GenBank) possible LysR-family transcriptional regulator
Organism
senr  Salmonella enterica subsp. enterica serovar Typhimurium DT2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 MarR_2 HTH_20
Motif
Other DBs
NCBI-ProteinID: CDG09282
LinkDB All DBs
Position
complement(3357725..3358621)
Genome map
AA seq 298 aa AA seqDB search
MAKERALTLEALRVMDAIDRRGSFAAAADELGRVPSALSYTMQKLEEELDVVLFDRSGHR
TKFTNVGRMLLERGRVLLEAADKLTTDAEALARGWETHLTLVTEALVPTPAFFPLIDRLA
AKANTQLSLITEVLAGAWERLEQGRADIVIAPDMHFRSSSEINSRKLYTLMNVYVAAPDH
PIHQEPEPLSEVTRVKYRGVAVADTARERPVLTVQLLDKQPRLTVSTIEDKRQALLAGLG
VATMPYSMVEQDIAEGRLRVVSPESTSEIDIIMAWRRDSMGEAKAWCLREIPKLFAGK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagagagagcgctgacgcttgaagcattgcgtgtgatggacgccattgaccgc
cggggcagttttgccgcagcggctgatgagttggggcgtgtgccctccgcgctgagttac
accatgcagaagctggaagaagagttggacgttgtactgttcgatcgctccggccatcgt
acaaaattcaccaacgtcggacgtatgctgctggaacgcgggcgggtattgctggaagcg
gcagacaagttaacgacggatgctgaagcgttggcccgcggttgggaaacgcatctgacg
ctagtcactgaagctctggtaccgacgcctgctttttttccactgatcgaccggctggcc
gctaaagccaatacgcagctttcattgattaccgaagtactggctggcgcatgggagcgg
cttgagcagggacgggcggatatcgttatcgctccggatatgcattttcgatcgtcgtcg
gaaattaactcccgtaagttgtatacgttaatgaatgtgtatgtcgccgcgcctgaccac
cctattcatcaggagccggagccgctttcggaagtgacgcgggttaaataccgcggcgta
gcggtagcggataccgcgcgcgagcggccggtattaacggtgcaactgctggataagcag
ccacgtctgacggtaagcacgattgaagataaacgtcaggcgctgctggccgggcttggc
gtcgcgaccatgccatattcgatggtggaacaggatattgccgaagggcggctacgcgtg
gtcagcccggaatcgaccagcgaaatcgatattattatggcctggcggcgcgacagtatg
ggggaggcaaaagcctggtgcctgcgggaaatacctaagctattcgccggaaaataa

DBGET integrated database retrieval system