KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_03745Help
Entry
Q786_03745        CDS       T02944                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens00010  Glycolysis / Gluconeogenesis
sens00260  Glycine, serine and threonine metabolism
sens00680  Methane metabolism
sens01100  Metabolic pathways
sens01110  Biosynthesis of secondary metabolites
sens01120  Microbial metabolism in diverse environments
sens01130  Biosynthesis of antibiotics
sens01200  Carbon metabolism
sens01230  Biosynthesis of amino acids
Module
sens_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sens_M00002  Glycolysis, core module involving three-carbon compounds
sens_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sens00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q786_03745 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    Q786_03745 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q786_03745 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sens04131]
    Q786_03745 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sens04147]
    Q786_03745 (gpmA)
Enzymes [BR:sens01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Q786_03745 (gpmA)
Membrane trafficking [BR:sens04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Q786_03745 (gpmA)
Exosome [BR:sens04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Q786_03745 (gpmA)
  Exosomal proteins of melanoma cells
   Q786_03745 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AHB43504
LinkDB All DBs
Position
complement(798542..799294)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPLKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcgtaagcgaagcaaaagca
gcgggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaggcgtggctgccg
gtggaaaaatcctggaaactcaatgaacgtcactatggcgcgttgcaggggctgaataaa
gcggaaacggcagaaaaatatggtgacgagcaggttaaacagtggcgccgcggttttgcc
gtgacgccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagaactgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagattcttgagttaaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgctcaaacattactatctgggcaacgctgacgaaatcgccgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system