KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_04175Help
Entry
Q786_04175        CDS       T02944                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens00550  Peptidoglycan biosynthesis
sens01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sens00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Q786_04175
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sens01002]
    Q786_04175
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sens01011]
    Q786_04175
Enzymes [BR:sens01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Q786_04175
Peptidases and inhibitors [BR:sens01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Q786_04175
Peptidoglycan biosynthesis and degradation proteins [BR:sens01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Q786_04175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase CD52
Motif
Other DBs
NCBI-ProteinID: AHB43586
LinkDB All DBs
Position
890754..891956
Genome map
AA seq 400 aa AA seqDB search
MTQYASSLRSLAAGSVLLFLFASPVKAEEQTIAPPGVDARAWILMDYASGKVLAEGNADE
KLDPASLTKIMTSYVVGQALKAGKIKLTDMVTVGKDAWATGNPALRGSSVMFLKPGDQVS
VADLNKGIIIQSGNDACIALADYVAGSQESFIGLMNAYAKRLGLTNTTFQTVHGLDAPGQ
FSTARDMALLGKALIHDVPDEYAIHKEKEFTFNNIRQPNRNRLLWSTNLHVDGMKTGTTA
GAGYNLVASATQGDMRLISVVLGAKTDRIRFNESEKLLTWGFRFFETVTPIKPDATFVTQ
RVWFGDKREVNLGAGDAGSVTIPRGQLKNLKASFTLNEPQLTAPLKKGQVVGTIDFQLNG
KSIEQRPLMVMENVEEGGFFSRMWDFVLMKLHQWFGSWFS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatacgcttcttcccttcgtagcctcgcggcaggttcggttctcttattcctt
ttcgcttcgcctgtaaaggcagaggaacaaacgatcgcgccgccgggcgttgatgcgcga
gcctggatcttaatggattacgccagcggtaaagtactggcggaaggcaacgccgatgag
aaactcgaccctgccagtttgacaaaaattatgaccagctacgtggtgggccaggcgctg
aaggcagggaaaatcaagctgaccgatatggtgacggtgggcaaagatgcttgggcgacg
gggaacccggcgctacgtgggtcgtcggtgatgtttctgaagccaggcgatcaggtgtcg
gttgcggatcttaataaaggcatcatcattcagtcaggtaatgatgcctgtatcgcgctt
gccgactacgtcgccggaagccaggagtcctttatcggcctgatgaacgcctatgcgaaa
cgactgggattaacgaatacaaccttccagacggtacacggtcttgatgcgccagggcag
ttcagtaccgctcgcgatatggcgttgctcggcaaggccttgattcacgatgtgcctgac
gaatacgccattcataaagagaaagaatttacttttaataatattcgtcaaccgaaccgc
aaccgcctgttgtggagcaccaatctgcatgtcgacggcatgaaaacggggacaacggca
ggggctggatataaccttgtcgcctccgccacccagggcgatatgcgcctgatctctgtc
gtgctgggggcgaaaacggaccgtattcgttttaatgagtcagaaaaactgctgacctgg
ggtttccgcttctttgaaacggtcacgccgattaaacctgacgcgacattcgtgacgcaa
cgggtctggtttggcgataagcgtgaggtcaatttgggggcgggcgatgcggggtctgtg
acgattccgcgtgggcagcttaaaaacctgaaggccagctttacgttgaacgaaccacag
ctcacggcgccgttgaagaaagggcaggttgtcggcaccatcgatttccagcttaacgga
aaatccattgagcaacgcccgttaatggtgatggaaaacgtcgaggaggggggatttttc
agccggatgtgggattttgtgctgatgaaactccatcagtggtttggcagttggttctcg
taa

DBGET integrated database retrieval system