KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_07110Help
Entry
Q786_07110        CDS       T02944                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Brite
KEGG Orthology (KO) [BR:sens00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Q786_07110
Enzymes [BR:sens01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     Q786_07110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Shikimate_DH Methyltransf_25 ThiF Pyr_redox_2 AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AHB44146
LinkDB All DBs
Position
complement(1497400..1498491)
Genome map
AA seq 363 aa AA seqDB search
MPLTRQLPTNNEVIIKMEKITCNACLAHAEKDVRFESREIEHSEHDVVVKVACGGICGSD
IHYYQHGRAGMSVLKHPMVIGHEFVGVISKVPAGSDLKVGQTVAVNPSSPCNQCEMCLSG
HQNLCGSMRFMGSAQFNPHVNGGFSEYVVVKPEQCIPYDRRVPANVMAFSEPLAVAIHAV
KKAGQLTGKRVLVIGAGPIGCLILAAARSAGASELVASDLSPRCLELARQMGATAVMDPR
DEEQVAHYQQHKGYFDVVFEASGAPIAVASSVDFTRPAGTIVQVGMGASPVSWPVSTMLV
KELNWVGSFRFIGEFITAVRWLEDGRIDPRPLISAEFPPQQIEDALITATDKNVSAKVLI
RFD
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgccattaacccggcaactgccaacaaataatgaggtcattatcaaaatggaaaaaata
acctgtaacgcttgtctggcccatgcggaaaaagacgtacgctttgaatcacgtgaaatc
gagcacagtgaacatgacgtcgtcgtgaaggtcgcctgcggcggcatctgtggctctgat
attcactactatcagcatggccgcgcggggatgtctgtcctcaagcatccgatggtgatt
ggccatgagtttgttggcgtgatcagcaaagtgccagcaggcagcgacctgaaagtgggc
cagacggttgcggtgaacccgtccagcccctgcaatcagtgcgagatgtgcctttccggc
catcaaaatctgtgcggctccatgcgctttatgggcagcgcgcagttcaatccgcatgtg
aatggcggtttttctgaatacgtggtggtaaaaccggagcaatgcattccttatgacagg
cgcgtgcccgcaaacgtaatggccttttcggaaccgctagcggtcgccattcatgcagta
aaaaaggcaggccagttgaccggcaaacgcgtactggtgattggcgcaggccccattggt
tgtctgatcctcgcggcggcgcgcagtgccggagcatctgaactggtagcatcagatctc
agcccacgctgtctggaactggcacgccaaatgggggccacagcagtgatggatccgcgc
gatgaagaacaggttgcccattatcagcagcataaaggctactttgatgtcgtgtttgag
gcctccggcgcgccgattgccgtggcatccagcgtcgacttcacccgccctgccggcact
atcgttcaggtggggatgggcgccagcccggtaagctggccggtgtcaacgatgctggtt
aaagaactcaactgggtcggctcattccgttttatcggtgagttcatcaccgcggtacgc
tggctggaagatgggcgcatcgatcctcgcccgcttatcagcgccgagttcccgccccag
caaattgaagacgcgctgattaccgccacagacaaaaatgtctctgctaaggtactcatt
cgtttcgattaa

DBGET integrated database retrieval system