KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_13410Help
Entry
Q786_13410        CDS       T02944                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens00250  Alanine, aspartate and glutamate metabolism
sens00280  Valine, leucine and isoleucine degradation
sens00310  Lysine degradation
sens00410  beta-Alanine metabolism
sens00640  Propanoate metabolism
sens00650  Butanoate metabolism
sens01100  Metabolic pathways
sens01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sens00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Q786_13410
   00650 Butanoate metabolism
    Q786_13410
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Q786_13410
   00280 Valine, leucine and isoleucine degradation
    Q786_13410
   00310 Lysine degradation
    Q786_13410
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Q786_13410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sens01007]
    Q786_13410
Enzymes [BR:sens01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Q786_13410
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Q786_13410
    2.6.1.48  5-aminovalerate transaminase
     Q786_13410
Amino acid related enzymes [BR:sens01007]
 Aminotransferase (transaminase)
  Class III
   Q786_13410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AHB45334
LinkDB All DBs
Position
2818349..2819632
Genome map
AA seq 427 aa AA seqDB search
MNTNNALMQRRHNAVPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
GIVSAVEAQLKKLSHTCFQVLAYEPYLALCERMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGAIAFSGAYHGRTHYTLSLTGKVHPYSAGMGLMPGHVYRALYPCPLHNVSD
DDAIASIERIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDQHGIMLIADE
VQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTGRADVMDAIAPGGLGGTYAG
NPIACAAALAVLDIFEQENLLQKANTLGNTLRDGLMEIAETHREIGDVRGLGAMIAIELF
ENGDPGKPNAALTADIVARARDKGLILLSCGPYYNILRILVPLTIEASQIRQGLEIIARC
FDEAKQA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaataacgctttaatgcagcgccgtcataacgccgttcctcgcggcgtgggg
cagattcacccgattttcgccgagcgggcggaaaattgtcgggtctgggatgtcgaaggc
cgtgagtatctcgatttcgcgggcggcattgccgtcctgaacactggtcatttacatccg
ggcattgtttcagcggtggaagcgcagctgaagaaattgtcgcatacctgttttcaggtg
ctggcctatgaaccgtacctggcgttgtgcgaacgcatgaaccagaaggtaccgggcgat
ttcgccaaaaaaacgttgctggtcacgaccggttcagaagcggttgaaaacgcggtgaaa
atcgcccgcgcggcgacaaaacgcagcggcgctatcgcgtttagcggcgcttaccacggt
cgtacccactacacgctctctctgaccgggaaagtacacccgtactctgctggtatggga
ttgatgccaggccatgtctaccgcgcgctttatccttgcccgctacacaacgtcagcgac
gacgacgcgatcgccagcattgaacgcatctttaaaaatgatgccgcgccggaagatatc
gccgccattattattgagccggtacagggcgaaggcggattttacgctgcctctcccgcg
tttatgcagcgactgcgcgcgctatgcgaccaacacggcattatgttgattgccgacgaa
gtgcaaagcggcgcgggccggaccggtacgctgttcgccatggaacagatgggcgttgcg
gcagatattaccacgtttgcgaaatcgatcgccggcggctttccgctggcaggcgttacc
ggccgggcagacgtgatggacgctatcgcgccgggcgggctgggcggcacctatgccgga
aacccgattgcctgcgccgccgcgctggcggtactggacattttcgagcaggaaaattta
ctgcaaaaggcgaatacgcttggcaacacgctgcgcgatggcctgatggagatagcggaa
acgcaccgtgagattggcgacgtgcgcggactgggcgccatgatcgccattgagttgttt
gaaaatggcgaccccggcaaaccgaacgcggctctgaccgccgacattgtggcccgcgcc
cgcgataaagggttaattctgctctcctgcggtccttactacaacatcttgcgcatcctc
gttccactcactattgaggcctcgcagattcggcaaggcctggagattatcgcccggtgc
tttgatgaggcgaaacaagcgtaa

DBGET integrated database retrieval system