KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty21a: TY21A_00650Help
Entry
TY21A_00650       CDS       T02648                                 

Definition
(GenBank) peptidoglycan synthetase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
sent  Salmonella enterica subsp. enterica serovar Typhi Ty21a
Pathway
sent00550  Peptidoglycan biosynthesis
sent01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sent00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TY21A_00650
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01501 beta-Lactam resistance
    TY21A_00650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sent01011]
    TY21A_00650
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sent03036]
    TY21A_00650
Enzymes [BR:sent01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     TY21A_00650
Peptidoglycan biosynthesis and degradation proteins [BR:sent01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   TY21A_00650
Chromosome and associated proteins [BR:sent03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    TY21A_00650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF1616
Motif
Other DBs
NCBI-ProteinID: AGK65760
LinkDB All DBs
Position
143132..144898
Genome map
AA seq 588 aa AA seqDB search
MKAAAKTQKSKRQEEQTNFISWRFALLCGCILLALVFLLGRAAWLQIIAPDMLVRQGDMR
SLRVQEVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGISVGDRWKALSTALNIP
LDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIG
FTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERL
QALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLAGTPKDAMRNRTIT
DVFEPGSTVKPMVVMTALQRGIVNENTVLNTVPYRINGHEIKDVARYSELTLTGVLQKSS
NVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQRWSDIERATFSFGYG
LMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERIFPESTVRTVVHMMESVALPGGG
GVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAPASQPRFALVVVINDPQAGKY
YGGAVSAPVFGAIMGGVLRTMNIEPDALATGEKNEFVINQGEGTGGRS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcggcaaaaacgcaaaaatcgaagcgccaggaagaacagaccaacttcatc
agttggcgttttgcgttgctgtgcggctgtattttactggcgctggtttttttacttgga
cgcgcggcgtggctacagattatcgccccggatatgctggtgcgtcagggcgatatgcgt
tcgctgcgtgttcaggaagtctccacctcacgcggtatgattaccgaccgttccgggcgt
ccactggcggtcagcgtaccggttaaggcgatctgggccgacccgaaagaagttcatgac
gccggcggcatcagcgtcggcgatcgctggaaagcgctttctactgcgctcaatattccg
ctcgatcagctctccgcccgtatcaacgccaacccgaaagggcgttttatttatctggcg
cgccaggtaaatcctgacatggcggactacatcaaaaaactcaaactgccggggattcat
ttgcgtgaagaatcacgccgctactacccgtcaggagaagtaaccgctcacctcatcggt
tttaccaacgttgacagtcaggggattgaaggcgttgaaaagagctttgataagtggctt
accggtcagcctggcgagcgaatcgtgcgtaaagaccgctatggccgcgtgattgaggat
atctcctccactgacagtcaggcagcgcacaacctggcgttaagcattgatgaacgctta
caggcgctggtttaccgcgaactgaacaacgcggtggcgtttaacaaggcggaatccggt
agcgcggtgctagtcgatgtcaataccggtgaagtactggcgatggcgaatagcccttcc
tataaccccaacaaccttgccggtacgccgaaagacgcgatgcgtaaccgtaccatcacc
gacgtgtttgaaccgggttctacggttaagccgatggtggtgatgactgcgcttcagcgc
ggtatcgtcaacgaaaatacggtgttgaataccgttccataccgaattaacggccacgaa
attaaagacgtggcgcgctacagcgaattaaccctgactggggttctacagaagtcgagt
aacgtcggtgtatccaaactggcgttagcgatgccgtcctcagcgttagtagatacttac
tcacgttttgggctaggaaaggcgaccaatttggggttggtcggagaacgcagtggctta
tatcctcaaaaacaacggtggtccgacatagagagggccaccttctctttcggctacggg
ctaatggtaacgccgttacagttagcgcgagtttatgcaacgatcggcagctatggcatt
tatcgcccgctgtcgattaccaaagttgatccgcctgtacccggcgaacgcatcttccct
gaatccaccgtacgcaccgtggtgcatatgatggaaagcgtggcgctgccgggcggcggc
ggcgtgaaggcggcaattaaaggctaccgtatcgcgattaaaaccggtacggcgaaaaaa
gtggggccggacggtcgctacatcaacaaatacattgcttacaccgcaggcgtcgcgcct
gcgagtcagccgcgcttcgcgctggtggttgtcatcaacgatccgcaggcgggtaaatac
tacggcggcgccgtttccgcgccggtatttggtgccatcatgggcggcgttctgcgcacc
atgaacatcgaaccggacgcgctggcaacgggcgaaaaaaatgaattcgtaattaatcaa
ggcgagggaacaggtggcagatcgtaa

DBGET integrated database retrieval system