KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty21a: TY21A_16800Help
Entry
TY21A_16800       CDS       T02648                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
sent  Salmonella enterica subsp. enterica serovar Typhi Ty21a
Pathway
sent00071  Fatty acid degradation
sent00280  Valine, leucine and isoleucine degradation
sent00281  Geraniol degradation
sent00310  Lysine degradation
sent00362  Benzoate degradation
sent00380  Tryptophan metabolism
sent00410  beta-Alanine metabolism
sent00640  Propanoate metabolism
sent00650  Butanoate metabolism
sent00903  Limonene and pinene degradation
sent00930  Caprolactam degradation
sent01100  Metabolic pathways
sent01110  Biosynthesis of secondary metabolites
sent01120  Microbial metabolism in diverse environments
sent01130  Biosynthesis of antibiotics
sent01200  Carbon metabolism
sent01212  Fatty acid metabolism
Module
sent_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sent00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    TY21A_16800 (fadB)
   00650 Butanoate metabolism
    TY21A_16800 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TY21A_16800 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TY21A_16800 (fadB)
   00310 Lysine degradation
    TY21A_16800 (fadB)
   00380 Tryptophan metabolism
    TY21A_16800 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TY21A_16800 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TY21A_16800 (fadB)
   00281 Geraniol degradation
    TY21A_16800 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TY21A_16800 (fadB)
   00930 Caprolactam degradation
    TY21A_16800 (fadB)
Enzymes [BR:sent01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     TY21A_16800 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TY21A_16800 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     TY21A_16800 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     TY21A_16800 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AGK68844
LinkDB All DBs
Position
3413722..3415851
Genome map
AA seq 709 aa AA seqDB search
MFDAPGSVNKLDTATVASLGQALEVLEKQHDLKGLLLRSNKAAFIVGADITEFLSLFLVP
EEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPET
KLGIMPGFGGSVRLPRMLGADSALEIIATGKDVGAEHALKIGLVDGVVKQEKLIEGAIAV
LRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGMVAQTAGKHYPAPMTAVKTIEA
AARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVKGKAKKLTKDIETPKQAAVLG
AGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAAKLLNKQLERGKIDGLKLAGVIST
IHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRPETVLASNTSTIPIGELASAL
ERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAWASKMGKTPIVVNNCPGFFVN
RVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAAGF
PQRMQKEYRDAIDALFDASRFGQKNGLGFWRYKEDSKGKPKKEEDAAVDDLLASVSQTKR
DFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADMALVYGLGFPPFHGGAFRWLDTQGS
AKYLDMAQQYQHLGPLYEVPEGLRDKTRHNEPYYPPVEPARPVGSLKTA
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgatgctccaggctcggtcaataaactcgacaccgcaaccgtcgccagcctcggc
caggcgcttgaggtgctggaaaagcaacacgatttaaaagggctgctgctgcgctctaat
aaagcggcctttattgtcggcgcggacatcaccgaatttctttcactgttcctcgtcccc
gaagagcagttaagccaatggctgcatttcgctaatagcgtctttaaccgtctggaagat
ttacccgtaccgacccttgccgccgtaaacggctatgcgctgggcggcgggtgtgaatgc
gtgctggcgaccgattaccgtctggcgacgccagacctccgtatcggtctgccggaaact
aaactgggcatcatgccgggtttcggcggctccgttcgtctgccgcgtatgctgggcgcg
gacagcgcgctggagattatcgcgacaggtaaagatgtcggtgctgagcacgcgctgaaa
atcggccttgtggacggcgtggtcaaacaagagaagctaattgaaggcgcgatagcggtg
ttacgccaggccattaccggcgatctcgactggagagctaaacgccagccgaaactggaa
ccgttgaaactcagcaaaattgaagcggcgatgagctttaccatcgctaaaggcatggtc
gcacaaacggcgggtaaacattatccggcgccgatgaccgcagtgaaaaccattgaagcc
gccgcgcgttttggtcgtgaagaagcgctgaatctggaaaataaaagctttgttccgctg
gcgcataccaatgaggctcgtgcgctggtcggtatcttcctcaacgatcaatatgtaaaa
ggtaaagccaaaaagctgaccaaagatattgagacgccgaaacaggcagccgtactgggc
gcgggcattatgggcggcggtatcgcttaccagtcggcctggaaaggcgtaccggtcatc
atgaaagatatcaacgataaatcgttgaacctcggcatgaccgaagcggccaagctgctg
aacaaacagctggagcgcggcaagatcgacggtctgaagctggcgggcgtcatttcgacc
atccacccgactctcgattatgccggtttcgatcgcgtagatgttgttgtcgaagcggta
gtcgaaaatccgaaagtcaaaaaagcggtactggcggaaaccgagcagaaagtgcgccca
gaaaccgtgctggcctcaaatacctccaccatcccaattggcgaactggcaagcgccctg
gaacgtccggaaaacttttgcggaatgcacttcttcaacccggtacaccggatgccgctg
gttgaaatcattcgcggcgagaagagttcagacgaaaccattgccaaagtcgtcgcctgg
gccagcaaaatgggcaagacaccgattgtagtcaacaactgccccggcttctttgttaac
cgcgtgctgttcccctatttcgccggtttcagtcaactgctgcgcgacggcgcggatttc
cgcaaagtcgataaagtgatggaaaaacagttcggctggccgatgggcccggcctatctg
ctcgacgtggtgggtattgataccgcccaccacgcgcaggcggtaatggcggcaggcttc
ccacaacggatgcagaaagagtatcgcgacgcgatcgacgcattgtttgacgccagccgt
tttgggcaaaaaaacggtctgggcttctggcgctataaagaagacagcaagggtaagccg
aagaaagaagaagatgctgcggtggatgacctgctggcaagcgtcagtcagacgaaacgc
gacttcagcgacgacgagataatcgcccgtatgatgatcccgatgattaacgaagtggtt
cgctgtctggaagaaggcattatcgcaagcccggcggaagccgatatggcgctggtctac
ggcctgggcttccctccgttccacggcggcgcattccgctggctggatacacagggcagc
gcgaaatatcttgatatggcgcagcagtatcaacacctcggcccgctgtatgaagtgccg
gaagggctgcgtgataaaacgcgccataacgaaccgtattatcccccggttgaaccagcc
cgtccggttggttctctgaaaacggcttaa

DBGET integrated database retrieval system