KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty21a: TY21A_21715
Entry
TY21A_21715       CDS       T02648                                 

Definition
(GenBank) hypothetical protein
Organism
sent  Salmonella enterica subsp. enterica serovar Typhi Ty21a
SSDB
Motif
Pfam: DUF3487 DUF3341
Other DBs
NCBI-ProteinID: AGK69773
LinkDB
Position
4430745..4431119
AA seq 124 aa
MKTIEFLPDRLNAETVVFRGFTTPELGYAALIGAVSGLILSLIMMLVTGIGWPIIPTCTL
ITPLIFIFIGGRFLVRFKRNKPNFYLYLRIQKILSHIGIGSKVLVRHDRRWSLRRSKPVR
KGGI
NT seq 375 nt   +upstreamnt  +downstreamnt
atgaaaacaatcgagtttttaccggacaggctgaatgccgaaacggtagttttcagaggg
tttacaacaccagaactgggctatgcagcacttattggtgccgtgtcaggcttaattttg
tctctgataatgatgcttgtaacggggatcggctggccaattattccaacctgtactctt
atcactccactgatatttatttttatcggtggacgctttctggttcgttttaaacgtaat
aaacccaatttttacctctacctccggattcaaaaaatactgagccatattggtatcggg
agcaaagttctggtccgtcatgatcgacgctggtcattacgcaggagtaagcctgtacgc
aaggggggaatatga

DBGET integrated database retrieval system