KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090332: AU39_03525Help
Entry
AU39_03525        CDS       T03760                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
senv  Salmonella enterica subsp. enterica serovar Enteritidis EC20090332
Pathway
senv00020  Citrate cycle (TCA cycle)
senv00190  Oxidative phosphorylation
senv00650  Butanoate metabolism
senv01100  Metabolic pathways
senv01110  Biosynthesis of secondary metabolites
senv01120  Microbial metabolism in diverse environments
senv01130  Biosynthesis of antibiotics
senv01200  Carbon metabolism
Module
senv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
senv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
senv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:senv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AU39_03525 (sdhA)
   00650 Butanoate metabolism
    AU39_03525 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AU39_03525 (sdhA)
Enzymes [BR:senv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AU39_03525 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     AU39_03525 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: AHP77422
LinkDB All DBs
Position
758104..759870
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMALRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEQGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGVLRDASESDVEGSLERLNRWNNNRNGEDPVAIRKALQECMQHNFSVFREGDAM
AKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDFPERDDANWLCHTLYQPQTESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccagtcagagaatttgatgctgttgtgattggtgccggtggcgcaggtatg
cgcgcggcgctgcaaatttcccagagcggccaaacctgtgcgctgctctcgaaagtcttc
ccgacccgttcccataccgtttccgcgcagggcggtatcaccgtggcgctcggcaatacc
catgaagataactgggaatggcacatgtacgataccgtaaaagggtcggactacattggt
gaccaggatgctatcgaatatatgtgtaagaccggaccggaagcgattctggaactggag
cacatggggctaccgttctcccgtcttgatgatggacgtatctatcagcgcccgttcggc
ggccagtcgaaaaactttggcggcgagcaggcggcacgtaccgcggcggcggctgaccgt
accggtcacgccttgctgcacacgttgtatcaacagaatttgaaaaaccacaccacgatt
ttctccgaatggtatgcgctggatctggtgaaaaaccaggatggcgcggtggtggggtgt
accgcactgtgcatcgaaaccggtgaagtggtgtacttcaaagcccgcgcgacggtgctg
gcgaccggcggcgcaggccgtatctaccagtccaccaccaacgctcacatcaacaccggt
gacggtgtcggtatggcgctgcgtgccggtgtcccggtgcaggacatggaaatgtggcag
ttccacccgaccggcatcgccggggcgggcgtgctggtgacagaaggctgccgcggcgaa
ggcggttacctgctgaacaaacacggcgagcgctttatggagcgttatgcgccgaatgcc
aaagacctggcgggtcgtgacgtggtggcgcgttccatcatgatcgaaatccgtgaaggc
cgcggctgtgatggtccgtgggggccgcacgctaaactgaaactggatcacctgggtaaa
gaggtgctggaatctcgcctgccgggtatcctggagctgtcccgtactttcgcccacgtt
gacccggtgaaagagccgattccggttatcccgacctgccactacatgatgggcggtatt
ccgactaaagtgaccggtcaggcgctgaccgtgaacgagcagggcgaagacgtggtcatt
ccggggctgtttgcggtaggcgaaatcgcctgtgtatcggttcacggcgccaaccgtctg
ggcggtaactcactgctggatctggtggtctttggccgcgcggcggggctgcatttacag
gaatccatcgccgagcagggcgtgctgcgcgacgccagcgagtctgacgttgaaggttct
ctggagcgcctgaatcgctggaacaataaccgcaatggcgaagatccggtggctatccgc
aaagcgttgcaggagtgtatgcagcataacttctccgtattccgtgaaggcgacgcgatg
gcgaaagggcttgagcagttgaaagtgatccgcgagcgtctgaaaaacgcccgtctggat
gacacgtccagcgagtttaatacccagcgtgttgagtgtctggagctggataacctgatg
gaaaccgcctacgccactgccgtatcagccaacttccgaacggaaagccgcggcgcgcat
agccgcttcgatttcccggagcgtgatgatgccaactggttgtgtcataccctgtatcag
ccgcaaacggaatccatgacgcgccgaagcgtcaatatggagccgaaactgcgtccggcg
ttcccgccgaagattcgtacttattaa

DBGET integrated database retrieval system