KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090332: AU39_03530Help
Entry
AU39_03530        CDS       T03760                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
senv  Salmonella enterica subsp. enterica serovar Enteritidis EC20090332
Pathway
senv00020  Citrate cycle (TCA cycle)
senv00190  Oxidative phosphorylation
senv00650  Butanoate metabolism
senv01100  Metabolic pathways
senv01110  Biosynthesis of secondary metabolites
senv01120  Microbial metabolism in diverse environments
senv01130  Biosynthesis of antibiotics
senv01200  Carbon metabolism
Module
senv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
senv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
senv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:senv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AU39_03530 (sdhB)
   00650 Butanoate metabolism
    AU39_03530 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AU39_03530 (sdhB)
Enzymes [BR:senv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AU39_03530 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     AU39_03530 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AHP77423
LinkDB All DBs
Position
759887..760603
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDNAPRMQDYTLEGEEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALTQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETDSRLEGMSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgaattttcgatttatcgttataacccggatgtcgataacgctccgcgtatg
caggattacaccctggaaggcgaagaagggcgcgacatgatgctgctggatgcgttaatc
cagcttaaagaaaaagatcccagcctttctttccgtcgttcctgccgcgaaggtgtgtgc
ggttctgatggtttgaatatgaacggtaagaatggtctggcctgtattacccctatttcg
gcgctgactcagccgggtaagaagattgtgattcgcccgctgcccggtttgccggtgatc
cgcgatttggtggtagacatggggcaattctacgcacaatatgagaagattaagccttac
ttattgaataatgggcaaaatccaccggctcgtgagcatctgcagatgccggagcagcgt
gaaaaactcgatgggctgtatgaatgtattctttgcgcctgttgctcaacatcctgcccg
tcattctggtggaacccggataagtttatcggtccggcggggctgctcgcggcgtatcga
ttcctgatcgatagtcgtgataccgagaccgacagtcgtctggaagggatgagcgatgca
ttcagcgtattccgctgtcacagcattatgaactgcgtcagtgtatgtcctaagggacta
aacccgacgcgcgctatcggccatattaagtcgatgctgttgcagcgtagcgcataa

DBGET integrated database retrieval system