KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090332: AU39_08275Help
Entry
AU39_08275        CDS       T03760                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
senv  Salmonella enterica subsp. enterica serovar Enteritidis EC20090332
Pathway
senv00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:senv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AU39_08275
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:senv02000]
    AU39_08275
Enzymes [BR:senv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AU39_08275
Transporters [BR:senv02000]
 Other Transporters
  Pores ion channels [TC:1]
   AU39_08275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N_2 GST_N GST_C_2 GST_N_3 GST_C_6 Tom37 Glutaredoxin2_C
Motif
Other DBs
NCBI-ProteinID: AHP78316
LinkDB All DBs
Position
1702889..1703494
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLREIGKDFTLDGVDLAKKRLENGDDYLAVNPKGQVPALLLDDG
TLLTEGVAIMQYLADSVPDRQLLAPVSSLARYHTLEWLNYIATELHKGFTPLFRPDTPET
LKPAVRAALEKKFQYVDESLSDDQWICGQRFTIADAYLFTVLRWAYGVKLNMDGLTHIES
YMQRVAKRPTVAAALKAEGLN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaaaccgggtgcctgctctcttgcttcccacattaccctgcgcgaa
attggcaaagactttacgcttgatggcgtcgatctcgcaaaaaaacgcctggaaaacggt
gatgattacctggcagtcaaccctaaaggacaggttccggctctgctgctggatgacggc
acactgttgactgaaggcgtcgccattatgcagtacctcgccgacagcgttcccgaccgc
cagcttctggcgccggtaagtagtcttgctcgctatcatacgctggaatggctcaactat
attgcaacggaactgcataaaggctttaccccgctgttccgccctgacacgccggaaact
cttaaacccgccgttcgcgccgctctggaaaagaaatttcagtatgtggatgaatcgctt
tcagacgaccagtggatttgcggccagcgttttaccatcgcagacgcttatctgtttacc
gtattgcgttgggcctatggcgtaaaactgaatatggacgggttaacgcatattgaaagt
tatatgcagcgtgtcgcaaaaagaccgaccgttgcggcagcgcttaaagcggaaggactg
aattaa

DBGET integrated database retrieval system