KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090332: AU39_11210Help
Entry
AU39_11210        CDS       T03760                                 

Definition
(GenBank) ATP-dependent helicase
  KO
K19789  DNA repair protein RadD
Organism
senv  Salmonella enterica subsp. enterica serovar Enteritidis EC20090332
Brite
KEGG Orthology (KO) [BR:senv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:senv03400]
    AU39_11210
DNA repair and recombination proteins [BR:senv03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factor
     AU39_11210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ResIII Helicase_C DEAD SWI2_SNF2 AAA_30 UPF0547 zf-tcix AAA_16 AAA_22 AAA DUF2075 SNF2_N DUF1845 DZR zinc_ribbon_2
Motif
Other DBs
NCBI-ProteinID: AHP78872
LinkDB All DBs
Position
2328077..2329837
Genome map
AA seq 586 aa AA seqDB search
MIFTLRPYQQEAVDATLSHFRRHRTPAVIVLPTGAGKSLVIAELARVARGRVLVLAHVKE
LVAQNHAKYCALGLEADIFAAGLKRKESQGKVVFGSVQSVARNLDAFQEEFSLLIVDECH
RIGDDEDSQYQQILTHLSKVNPHLRLLGLTATPFRLGKGWIYQFHYHGMVRGNDNALFRD
CIYELPLRYMIKHGYLTPPERLDMPVVQYDFSRLQAQSNGLFSEADLNRELKKQQRITPH
IISQIMEFAQTRKGVMIFAATVEHAKEIVGLLPADDAALITGDTPGPERDALIDNFKAQR
FRYLVNVSVLTTGFDAPHVDLIAILRPTESVSLYQQIVGRGLRLAPGKTDCLILDYAGNP
HDLYAPEVGSPKGKSDNVPVQVFCPACGFANTFWGKTTADGTLIEHFGRRCQGWFDDDDG
HREQCDFRFRFKNCPQCNAENDIAARRCRECDAILVDPDDMLKAALRLKDALVLRCSGMT
MQHGQDEKGEWLKITYYDEDGADVSERFRLHTPAQRTAFEQLFIRPHTRTPGVPLRWITA
ADIVAQQALLRHPDFVVARMKGQYWQVREKVFDYEGRFRRAHELRG
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgatttttacactccgcccctaccagcaagaagccgtagacgccacgctcagccacttt
cgccgccaccgtacgcccgccgtgattgttctgccgaccggcgcaggtaaaagcctggtg
atcgccgaactggcgcgcgtcgcccgcggacgggtactggtgctggcgcatgtgaaagag
ctggtcgcgcagaaccacgccaaatattgcgcgctggggctggaagcagatattttcgcc
gccggactcaaacgtaaagagagtcagggcaaagtcgtgttcggcagcgtacagtcggtg
gcgcgtaatcttgacgccttccaggaggagttttcgctgttgattgtcgatgaatgccac
cgcatcggtgacgatgaagacagtcagtatcagcaaatcctcactcacctgagtaaagtt
aatcctcacttacgtctgcttgggctaaccgccacgcccttccgcctcggaaaaggctgg
atttatcaatttcattaccacggtatggtgcgcggcaacgacaacgcgctgtttcgcgac
tgtatttatgaactgccgctgcgctatatgattaaacacggctatctgacgccgcctgag
cggcttgatatgccagtggtccaatacgatttcagccgcctgcaggcccaaagcaatggg
ctgttcagcgaagccgacctgaaccgtgagctgaaaaagcagcagcggattacgccgcac
atcatcagccagattatggaatttgcgcaaacgcgcaaaggcgtgatgattttcgccgcc
acggtcgaacatgcgaaagagattgtcggtctgcttccggcggacgacgcggcgctgatt
accggcgatacgccagggcccgagcgcgacgcgctgattgataatttcaaggcgcagcgt
tttcgctatctggttaacgtctcggtgctgaccaccggctttgacgccccacacgttgat
ctcatcgcgattctacgtcccaccgagtcagttagtctttaccaacaaattgtcgggcgt
ggtctgcgccttgcgccgggaaagaccgattgcctgattcttgattacgcaggcaacccg
cacgacctgtatgccccggaggtcggtagcccgaagggaaaaagcgataacgtccctgtc
caggtattttgcccggcctgcggctttgccaacaccttctgggggaaaaccactgccgac
ggcacgctgattgaacactttggccgtcgctgccagggctggtttgacgatgacgacggc
catcgcgagcagtgcgattttcgctttcgcttcaaaaactgcccgcagtgtaatgccgaa
aacgatattgccgcccgacgctgccgggaatgtgacgctattctggtcgacccggacgat
atgttaaaagcggcgctcagactcaaggatgcgttagtcctgcgctgtagcggaatgacg
atgcagcatgggcaggatgagaaaggcgaatggctgaaaatcacttactatgacgaggac
ggcgcggatgtcagtgagcgcttccgcttgcacacgcccgcccagcgtaccgctttcgaa
cagctatttattcgcccgcatacccgcacgcccggcgttcctttacgctggatcacggcg
gcggatattgtcgcgcagcaggcgctgttgcggcatcccgattttgtggtcgcgcggatg
aaaggccagtactggcaggtgcgtgaaaaagtgttcgactatgaaggccgcttccgccgg
gcgcacgaattacgtggttaa

DBGET integrated database retrieval system