KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090332: AU39_11250Help
Entry
AU39_11250        CDS       T03760                                 

Definition
(GenBank) E3 ubiquitin--protein ligase
  KO
K15353  E3 ubiquitin-protein ligase SspH2
Organism
senv  Salmonella enterica subsp. enterica serovar Enteritidis EC20090332
Pathway
senv05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:senv00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    AU39_11250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NEL LRR_4 TTSSLRR LRR_8 Sif WYL
Motif
Other DBs
NCBI-ProteinID: AHP78878
LinkDB All DBs
Structure
PDB: 

Position
complement(2334979..2337345)
Genome map
AA seq 788 aa AA seqDB search
MPFHIGSGCLPATISNRRIYRIAWSDTPPEMSSWEKMKEFFCSTHQTEALECIWTICHPP
AGTTREDVVSRFELLRTLAYAGWEESIHSGQHGENYFCILDEDSQEILSVTLDDAGNYTV
NCQGYSETHRLTLDTAQGEEGTGHAEGASGTFRTSFLPATTAPQTPAEYDAVWSAWRRAA
PAEESRGRAAVVQKMRACLNNGNAVLNVGESGLTTLPDCLPAHITTLVIPDNNLTSLPAL
PPELRTLEVSGNQLTSLPVLPPGLLELSIFSNPLTHLPALPSGLCKLWIFGNQLTSLPVL
PPGLQELSVSDNQLASLPALPSELCKLWAYNNQLTSLPTLPSGLQELSVSDNQLASLPTL
PSELYKLWAYNNRLTSLPALPSGLKELIVSGNRLTSLPVLPSELKELMVSGNRLTSLPML
PSGLLSLSVYRNQLTRLPESLIHLSSETTVNLEGNPLSERTLQALREITSAPGYSGPIIQ
FDMAGASAPRETRALHLAAADWLVPAREGEPAPADRWHMFGQEDNADAFSLFLDRLSETE
NFIKDAGFKAQISSWLAQLAEDEALRANTFAMATEATSSCEDRVTFFLHQMKNVQLVHNA
EKGQYDNDLAALVATGREMFRLGKLEQIAREKVRTLALVDEIEVWLAYQNKLKKSLGLTS
VTAEMRFFDVSGVTVTDLQDAELQVKAAEKSEFREWILQWGPLHRVLERKAPERVNALRE
KQISDYEETYRMLSDTELRPSGLVGNTDAERTIGARAMESAKKTFLDGLRPLVEEMLGSY
LNVQWRRN
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgccctttcatattggaagcggatgtcttcccgccaccatcagtaatcgccgcatttat
cgtattgcctggtctgataccccccctgaaatgagttcctgggaaaaaatgaaggaattt
ttttgctcaacgcaccagactgaagcgctggagtgcatctggacgatttgtcacccgccg
gccggaacgacgcgggaggatgtggtcagcagatttgaactgctcaggacgctcgcgtat
gccggatgggaggaaagcattcattccggccagcacggggaaaattacttctgtattctg
gatgaagacagtcaggagatattgtcagtcacccttgatgatgccgggaactataccgta
aattgccaggggtacagtgaaacacatcgcctcaccctggacacagcacagggtgaggag
ggcacaggacacgcggaaggggcatccgggacattcaggacatccttcctccctgccaca
acggctccacagacgccagcagagtatgatgctgtctggtcagcgtggagaagggctgca
cccgcagaagagtcacgcggccgtgcagcagtggtacagaaaatgcgtgcctgcctgaat
aatggcaatgcagtgcttaacgtgggagaatcaggtcttaccaccttgccagactgttta
cccgcgcatattaccacactggttattcctgataataatctgaccagcctgccggcgctg
ccgccagaactgcggacgctggaggtctctggtaaccagctgactagcctgccggtgctg
ccgccaggactactggaactgtcgatctttagtaacccgctgacccacctgccggcgctg
ccgtcaggactatgtaagctgtggatctttggtaatcaactgaccagcctgccggtgttg
ccgccagggctacaggagctgtcggtatctgataaccaactggccagcctgccggcgctg
ccgtcagaattatgtaagctgtgggcctataataaccagctgaccagcctgccgacgttg
ccgtcagggctacaggagctgtcggtatctgataaccaactggccagcctgccgacgctg
ccgtcagaattatataagctgtgggcctataataatcggctgaccagcctgccggcgttg
ccgtcaggactgaaggagctgattgtatctggtaaccggctgaccagtctgccggtgctg
ccgtcagaactgaaggagctgatggtatctggtaaccggctgaccagcctgccgatgctg
ccgtcaggactactgtcgctgtcggtctatcgtaaccagctgacccgcctgccggaaagt
ctcattcatctgtcttcagagacaaccgtaaatctggaagggaacccactgtctgaacgt
actttgcaggcgctgcgggagatcaccagcgcgcctggctattcaggccccataatacaa
ttcgatatggcgggagcctccgccccccgggaaactcgggcactgcacctggcggccgct
gactggctggtgcctgcccgggagggggaaccggctcctgcagacagatggcatatgttc
ggacaggaagataacgccgacgccttcagcctcttcctggacagactgagtgagacggaa
aacttcataaaggacgcggggtttaaggcacagatatcgtcctggctggcacaactggct
gaagatgaggcgttgagagcaaacacctttgctatggcaacagaggcaacctcaagctgc
gaggaccgggtcacattttttttgcaccagatgaagaacgtacagctggtacataatgca
gaaaaagggcaatacgataacgatctcgcggcgctggttgccacggggcgtgagatgttc
cgtctgggaaaactggaacagattgcccgggaaaaggtcagaacgctggctctcgttgat
gaaattgaggtctggctggcgtatcagaataagctgaagaaatcactcgggctgaccagc
gtgacggcagaaatgcgtttctttgacgtatccggcgtgacggttacagaccttcaggac
gcggagcttcaggtgaaagccgctgaaaaaagcgagttcagggagtggatactgcagtgg
gggccgttacacagagtgctggagcgcaaagcgccggaacgcgttaacgcgcttcgtgaa
aagcaaatatcggattatgaggaaacgtaccggatgctgtctgacacagagctgagaccg
tctgggctggtcggtaataccgatgcagagcgcactatcggagcaagagcgatggagagc
gcgaaaaagacatttttggatggcctgcgacctcttgtagaggagatgctggggagctat
ctgaacgttcagtggcgtcgtaactga

DBGET integrated database retrieval system