KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090332: AU39_11950Help
Entry
AU39_11950        CDS       T03760                                 

Definition
(GenBank) beta-ketoacyl-ACP synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
senv  Salmonella enterica subsp. enterica serovar Enteritidis EC20090332
Pathway
senv00061  Fatty acid biosynthesis
senv00780  Biotin metabolism
senv01100  Metabolic pathways
senv01212  Fatty acid metabolism
Module
senv_M00083  Fatty acid biosynthesis, elongation
senv_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:senv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AU39_11950
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AU39_11950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:senv01004]
    AU39_11950
Enzymes [BR:senv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     AU39_11950
Lipid biosynthesis proteins [BR:senv01004]
 Fatty acid synthase
  Component type
   AU39_11950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: AHP79012
LinkDB All DBs
Position
complement(2482685..2483899)
Genome map
AA seq 404 aa AA seqDB search
MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLI
DRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAM
RSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLG
KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV
EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT
STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN
IEELDEQAAGLNIVTETTERELTTVMSNSFGFGGTNATLVMRKL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgcagtgattactggcctgggcatcgtttccagcatcggtaataaccagcag
gaagtcctggcatctctgcgtgaaggacgttcagggatcactttctctcaggagctgaag
gacgccggcatgcgtagccaggtatggggcaacgtaaaactggataccactggcctcatt
gaccgcaaagtcgtgcgctttatgagcgacgcctccatctatgcttatctgtctatggag
caggcagtggccgacgccggtctggcgccggaagtctatcagaataacccgcgtgtcggc
ctaattgcaggttccggcggcggctccccgaaattccaggtctttggcgcagatgccatg
cgtagcccgcgtggtctgaaagccgtgggcccgtatgtggtgacgaaagcaatggcatcc
ggcgtttccgcctgcctcgctacgccgtttaaaatttatggcgtgaactactccattagt
tccgcttgcgcgacctccgcacactgtatcggcaatgcggttgaacagatccaactgggc
aaacaggacatcgtttttgctggcggcggcgaagagctgtgctgggaaatggcctgtgag
ttcgatgcgatgggcgcactgtccaccaaatataacgatacgcctgaaaaagcgtcccgt
acctatgatgcgcaccgtgatgggtttgtcatcgcgggcggtggcggtatggttgttgtc
gaagagctggaacacgctctggcgcgcggcgcgcatatctatgcggaaatcgtcggttac
ggcgcaacatccgacggcgcagacatggttgctccgtctggtgaaggcgcagtacgttgc
atgcagatggcgatgcacggcgtagacacgccgatcgactacctgaactctcacggtacg
tccacgccggtaggcgacgtgaaagaactcggtgcaatccgtgaagtgtttggcgataac
agcccggctatctccgcgaccaaagcgatgaccggccactcgctgggtgcggctggcgtg
caggaagccatctactctctgctgatgctggagcacggttttatcgcgccgagtatcaac
atcgaagagctggatgagcaggctgcgggtctgaacatcgtgaccgaaacgaccgagcgt
gaactgactaccgtaatgtctaacagcttcggttttggcggcaccaacgccacgctggtg
atgcgtaagttgtaa

DBGET integrated database retrieval system