KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090332: AU39_13385Help
Entry
AU39_13385        CDS       T03760                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
senv  Salmonella enterica subsp. enterica serovar Enteritidis EC20090332
Pathway
senv00250  Alanine, aspartate and glutamate metabolism
senv00280  Valine, leucine and isoleucine degradation
senv00410  beta-Alanine metabolism
senv00640  Propanoate metabolism
senv00650  Butanoate metabolism
senv01100  Metabolic pathways
senv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:senv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AU39_13385
   00650 Butanoate metabolism
    AU39_13385
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AU39_13385
   00280 Valine, leucine and isoleucine degradation
    AU39_13385
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AU39_13385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:senv01007]
    AU39_13385
Enzymes [BR:senv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AU39_13385
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AU39_13385
Amino acid related enzymes [BR:senv01007]
 Aminotransferase (transaminase)
  Class III
   AU39_13385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AHP79284
LinkDB All DBs
Position
2826525..2827808
Genome map
AA seq 427 aa AA seqDB search
MNTNNALMQRRHNAVPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
GIVSAVEAQLKKLSHTCFQVLAYEPYLALCERMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGAIAFSGAYHGRTHYTLSLTGKVHPYSAGMGLMPGHVYRALYPCPLHNVSD
DDAIASIERIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDQHGIMLIADE
VQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTGRADVMDAIAPGGLGGTYAG
NPIACAAALAVLDIFEQENLLQKANTLGKTLRDGLMEIAETHREIGDVRGLGAMIAIELF
ENGDPGKPNAALTADIVARAREKGLILLSCGPYYNILRILVPLTIEASQIRQGLEIIAQC
FDEAKQA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaataacgctttaatgcagcgccgtcataacgccgttcctcgcggcgtgggc
cagattcacccaattttcgccgagcgggcggaaaattgtcgggtctgggatgtcgaaggc
cgtgagtatctcgatttcgcgggcggcattgccgtcctgaacaccggtcatttacatccg
ggcattgtttcagcggtcgaagcgcagttgaagaaattgtcccatacctgttttcaggtg
ctggcctatgaaccgtatctggcgttgtgcgaacgcatgaaccagaaggtaccgggcgat
ttcgccaaaaaaacgttgctggtcacgaccggttcagaagcggttgaaaacgccgtgaaa
atcgcccgcgcggcaacaaaacgcagcggcgctatcgcgtttagcggcgcttaccacggt
cgtacccactacacgctctctctgaccgggaaagtacacccgtactctgctggtatggga
ttgatgccaggccatgtctaccgcgcgctttatccttgcccgctacacaacgtcagcgac
gacgacgcgatcgccagcattgaacgcatctttaaaaatgatgccgcgccggaagatatc
gccgccattattattgagccggtacagggcgaaggcggattttacgccgcctctcccgcg
tttatgcagcgactgcgcgcgctatgcgaccaacacggcattatgttgattgccgacgaa
gtgcaaagcggcgcgggccggaccggtacgctgttcgccatggaacagatgggcgttgcg
gcagatattaccacgtttgcgaaatcgatcgccggcggctttccgctggcaggcgttacc
ggccgggcagacgtgatggacgctatcgcgccgggcgggctgggcggcacctatgccgga
aacccgattgcctgcgccgccgcgctggcggtactggacattttcgagcaggaaaatcta
ctgcaaaaggcgaatacgcttggcaaaacgctgcgcgatggcctgatggagatagcggaa
acgcaccgtgagattggtgacgtgcgcggactgggcgccatgatcgccattgagttgttc
gaaaatggcgaccccggcaaaccgaacgcggctctgaccgccgacattgtggcccgcgcc
cgcgagaaagggttaattctgctctcctgcggtccttactacaacatcttgcgcatcctc
gttccactcactattgaggcctcgcagattcggcaaggcctggagattatcgcccagtgc
tttgatgaggcgaaacaagcgtaa

DBGET integrated database retrieval system