KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090332: AU39_13390Help
Entry
AU39_13390        CDS       T03760                                 

Definition
(GenBank) GABA permease
  KO
K11735  GABA permease
Organism
senv  Salmonella enterica subsp. enterica serovar Enteritidis EC20090332
Brite
KEGG Orthology (KO) [BR:senv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:senv02000]
    AU39_13390
Transporters [BR:senv02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   AU39_13390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2
Motif
Other DBs
NCBI-ProteinID: AHP79285
LinkDB All DBs
Position
2827938..2829338
Genome map
AA seq 466 aa AA seqDB search
MGQLSESHALGGGLKSRHVTMLSIAGVIGASLFVGSSVAIAEAGPAVLLAYLFAGLLVVM
IMRMLAEMAVATPDTGSFSTYADKAIGPWAGYTIGWLYWWFWVLVIPLEANIAAIILNSW
IPGIPVWLFSLVITLALTGSNLLSVKNYGEFEFWLALCKVIAILAFIALGATAISGFYPY
AEVSGISRLWDHGGFMPNGFGAVLSAMLITMFSFMGAEIVTIAAAESDTPDKHIVRATNS
VIWRISIFYLCSIFVVVALIPWNMPGLKSVGSYRSVLELLHIPHAKFIMDCVILLSVTSC
LNSALYTASRMLYSLSRRGDAPAIMGKTNRSKTPWVAVLLSTGAAFLTVIVNYYAPAKVF
KFLIDSSGAIALLVYLVIAISQLRMRKILLAQGGEIKLKMWLYPWLTWLVIGFICFVLVV
MLFRPAQQLEVISTGLLGLGIIGTVPIMSRWKKLIRWQKAPLQNLR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggggcaattgtcagaatcacatgcattagggggcgggctgaaatcacgccacgtcacc
atgttatcgatcgccggcgtcatcggcgccagcctgtttgtcggttccagcgtggcgatt
gcggaggccggccctgcggtactgctggcctatctgttcgcaggacttttagtcgtcatg
attatgcgaatgctggctgaaatggccgtcgccacaccggataccggttctttttccacc
tatgcggataaagcgatcggcccctgggccgggtataccatcggctggttatactggtgg
ttttgggtgctggttattccgctggaggccaatattgccgccattattctgaattcatgg
ataccgggtattccggtatggctattttcattagtgattacgcttgccttaaccggaagc
aatttattgagcgtcaaaaattacggcgagttcgaattctggctggcgctatgtaaagta
attgccattctggcgtttatcgcgctgggcgcgacagcgattagcggtttttatccgtat
gctgaggtaagcggtatctcccggctatgggatcacggtggttttatgcctaacggcttc
ggcgcggtgttaagcgccatgttgatcaccatgttctcttttatgggcgcggaaatcgtc
actattgctgccgcggaatccgatacgccggataaacatatcgtacgcgccaccaattct
gttatctggcgaatttccatcttttacctgtgttccatttttgtggtggtggcgctgatc
ccgtggaatatgccgggtctgaaaagcgtaggttcgtaccgttcggtactggagctgctt
catattccgcacgcaaaattcattatggactgcgtgattttgttgtcggtgaccagttgt
ctgaactccgcattatataccgcctcccggatgctctattcccttagccgccgcggcgat
gcgcctgcgataatgggaaaaactaaccgtagcaaaacgccctgggtggcggttctcctc
tctaccggcgcggcctttttaaccgttatcgtcaattattacgccccggcaaaagtgttt
aaatttcttatcgacagttccggcgccatcgcgctgctggtctatctggtgattgcgatt
tcgcaattgcggatgcgtaaaattctgctggcgcagggcggagaaattaagttgaaaatg
tggctttatccgtggctcacctggctggttatcggctttatctgctttgttctggtggtg
atgctatttcgaccggcacagcaactagaagtcatttcaacggggctgttagggctgggc
ataataggtactgtccccattatgtctcgctggaaaaaactgataaggtggcaaaaagcc
cccctgcaaaacctacgttag

DBGET integrated database retrieval system