KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090332: AU39_20265Help
Entry
AU39_20265        CDS       T03760                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
senv  Salmonella enterica subsp. enterica serovar Enteritidis EC20090332
Pathway
senv00620  Pyruvate metabolism
senv00680  Methane metabolism
senv01100  Metabolic pathways
senv01120  Microbial metabolism in diverse environments
senv01200  Carbon metabolism
Module
senv_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:senv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AU39_20265
  09102 Energy metabolism
   00680 Methane metabolism
    AU39_20265
Enzymes [BR:senv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AU39_20265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AHP80582
LinkDB All DBs
Position
complement(4207548..4210199)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGETIKDALGEHILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKNQPDLNDA
TIKKAVESLSLELVLTAHPTEITRRTLIHKMGEINNCLKQLDNTDIADYERHQVMRRLRQ
LIAQSWHTDEIRKQRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEENLGYKLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIHVLVSELSMVDATPELL
ALVGEEGASEPYRYLMKKLRARLMATQSWLEARLKGEKLPKPAGLLTQNEQLWEPLYACY
QSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDIRQESTRHTEALGEITRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRNWEPSNDTREVLETCKVIAEAPKGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFAMPVAPLFETLDDLNNADDVMTQLLNIDWYRGLIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTVSSLSLYTSAILEANLLPPPEPKDSWRHIMDEL
SVISCETYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGTALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFSKADLWLAD
YYDQRLVAKTLWPLGKELRDLLEEDIKVVLAIANDSHLMADLPWIAESIQLRNVYTDPLN
VLQAELLYRSRLTEEQGKSPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcgttgcgtagtaatgtcagtatgctcggcaaggtgctggga
gaaaccatcaaggatgcgctgggagaacacattcttgatcgcgtagaaacaatccgtaag
ctatccaaatcttcacgcgccggcaatgaagctaatcgccaggagctgctcaccacgcta
caaaatttgtctaatgacgagctgctgccagttgcgcgcgcgtttagtcagttcctgaac
ctggccaatactgccgagcaataccacagcatttcgccaaaaggcgaagccgccagcaac
ccggaagtgattgcccgcactctgcgcaaactgaaaaaccaaccggacctcaacgacgca
accatcaaaaaagcggtagagtcgctgtcgctggagttggtgctaaccgcccatccgaca
gaaattacccgccgtacgcttattcacaagatgggtgaaatcaataactgtctgaaacag
cttgataataccgatatcgccgactacgaacgtcaccaggtgatgcgtcgcctgcgccag
ttgattgcccaatcctggcatacggatgagatccgcaagcagcgcccaagcccggtggat
gaagccaaatggggcttcgccgtggttgagaacagcctgtggcagggcgtacctaactat
ctgcgtgaactgaacgaacagctggaagaaaatctcggctacaaattgccggtggatttt
gtgccggtacgttttacctcctggatgggcggcgaccgtgacggcaacccgaacgtgacg
gcggatatcacccgccacgtgctcttgttaagccgctggaaagccaccgatctgttcctg
aaagacattcatgttctggtatcagaactgtcgatggtcgacgccacgccggagctgctg
gcgttagtgggcgaagaaggcgcgtctgagccgtatcgctacctgatgaaaaaattgcgc
gcccgtctgatggcgacccagtcctggctggaagcgcgtctgaaaggcgagaagctgccc
aaaccggctggcctgctgacgcaaaacgagcagctctgggaacctctgtacgcctgctac
cagtcgttacaggcctgcggcatgggcattatcgccaacggcgagttactcgacacgctc
cgccgcgtgaagtgtttcggcgtaccgctggtgcgtattgatatccgtcaggagagcacc
cgccataccgaagcgctgggcgaaattacccgctacctcggtattggcgactacgaaagc
tggtcggaagccgacaagcaggccttcctgatccgcgagctgaactccaaacgtccgctg
ctgccgcgtaactgggagccgagcaacgatacccgcgaagtgcttgaaacctgcaaggtt
attgccgaagcgccaaaaggatcgatcgccgcctacgtaatttcaatggcgaaaacgccg
tctgatgtgctggctgtgcatctgctgctgaaagaggcaggtatcggctttgccatgccg
gtcgcgccgctgtttgaaaccctcgacgacctgaacaatgccgacgacgtgatgacccag
ttgttgaatatcgactggtatcgcggactgattcagggtaagcagatggtcatgatcggc
tactccgactcggcgaaagacgccggcgtcatggccgcgtcatgggcgcagtatcaggcg
caggacgccctgatcaaaacctgtgaaaaagccggcatcgagcttaccctcttccacggc
cgcggcggttctattggccgtggcggcgcgccagcccacgcggcgctgctttcgcaaccg
ccaggcagtctgaaaggcggtctgcgcgtgaccgagcagggcgagatgatccgcttcaaa
tacggcctgccggaagtcaccgtcagcagcctctcgctctacaccagcgcaattctggaa
gcaaacctgctgccgccgccggaaccgaaagacagctggcgtcatattatggatgagctt
tccgtcatctcctgtgaaacctaccgcggctacgtgcgcgaaaataaagactttgtaccg
tacttccgctccgcgacgccggagcaagagttgggcaaattgccgctcggctcacgtccg
gcgaaacgtcgtccaactggcggcgtcgaatcgctgcgcgcgattccgtggatcttcgcc
tggacgcaaaaccgcctgatgctgccagcctggctgggcgcgggtactgcgctgcaaaaa
gtggtggaagacggtaaacaaagcgaactggaagccatgtgccgcgactggccgttcttc
tccacgcgtcttgggatgctggaaatggtgttctcgaaagccgacctgtggctggccgac
tattacgatcagcgtctggtggcgaaaacgctatggccgctgggcaaagagctacgagac
ctgctggaagaagacattaaagtggtgctggcgattgccaacgattcgcacctgatggcc
gacttaccgtggattgcggagtccattcagttaagaaacgtttataccgatccattaaac
gtgttgcaggccgagttgctgtatcgttcccgtctgactgaagagcagggcaaatcgccc
gatcctcgcgtcgaacaggcgttgatggtcacgattgcgggcgtcgccgccggtatgcgc
aacaccggctaa

DBGET integrated database retrieval system