KEGG   Sodalis endosymbiont of Henestaris halophilus: HBA_0617Help
Entry
HBA_0617          CDS       T05311                                 

Gene name
aroC
Definition
(GenBank) Chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
seny  Sodalis endosymbiont of Henestaris halophilus
Pathway
seny00400  Phenylalanine, tyrosine and tryptophan biosynthesis
seny01100  Metabolic pathways
seny01110  Biosynthesis of secondary metabolites
seny01130  Biosynthesis of antibiotics
seny01230  Biosynthesis of amino acids
Module
seny_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:seny00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HBA_0617 (aroC)
Enzymes [BR:seny01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     HBA_0617 (aroC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: SNC58859
UniProt: A0A2C8CX68
LinkDB All DBs
Position
I:complement(1034338..1035423)
Genome map
AA seq 361 aa AA seqDB search
MAGNSIGQIFCVTTFGESHGPALGAIVDGIPPGIPLREEDLQYDLNRRRPGMSRYTTQRR
EPDRVKILSGVFEGITTGTSLGLLIENTDQRSQDYISIKDLYRPGHADYSYEKKYGKRDY
RGGGRSSARETAMRVAAGAIAKKYLTQQCGVQVRGFLAQMGEIRCELKDWAQVEQNPFFC
PDIDRLKELDALMRDLKKAGDSIGAKITVIVDNLPAGLGEPVFDRLDADLAHALMSINAV
KGVEIGDGVEVINKLGSENRDEITHEGFQSNHAGGILGGISSGQPVIAHLSLKPTSSIMV
PGRTVNRKGEDVQIVTRGRHDPCVGIRAVPIAEAMIAIVLMDHLLRQRAQCADVVAPISI
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaacagtattggacaaattttttgtgttacaacctttggtgaatctcacgga
ccggcgcttggagcgatcgtcgacggtataccacccggtatcccattgagagaagaagat
ctgcaatacgatcttaaccgacgccgtccaggcatgtcgcgctataccactcaacgtcgc
gaaccggatcgcgtaaagatcctttcaggcgtatttgaaggcattactactggtactagt
ctcggtctacttatcgaaaatactgatcagcgctcacaagattacatctctatcaaagat
ctctatcggccaggacacgccgattacagctatgaaaaaaagtatggcaagcgagattat
cgcgggggaggccgttcatcggcgagagaaacggcaatgcgcgtcgccgcaggagctatt
gccaaaaaatatttaacacaacaatgcggagtgcaagtgcgcggttttctagcacaaatg
ggcgagattcgctgcgaactcaaagattgggctcaggtagaacaaaatccgtttttctgc
ccagatattgaccgactaaaggaactagatgcgctaatgcgtgatctaaaaaaagctggt
gattctattggtgccaaaataaccgttattgtggataatttgccagccggcctaggagag
ccggtattcgaccgccttgatgctgatttggcccacgcgctaatgagcattaacgctgtg
aaaggagtcgagataggcgatggcgtcgaagtgataaacaaactaggcagcgaaaaccgt
gacgagatcacccacgaaggctttcaaagcaatcacgcaggcgggattttaggtggtatt
agcagtggccagccagtgatagctcatctttccctgaaacccacttctagcattatggtg
ccaggtaggacagtaaaccgcaaaggtgaggatgtacagatagttacccgcggtcggcat
gatccctgcgtcggcattcgcgcagtgcctatcgcagaagccatgatagcgatcgtacta
atggatcacttgttgcgacagcgagcgcaatgcgccgatgtagttgcaccaatatcaata
tcgtaa

DBGET integrated database retrieval system