KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_1184Help
Entry
STM14_1184        CDS       T01714                                 

Gene name
sodC_1
Definition
(GenBank) superoxide dismutase precursor
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Brite
Enzymes [BR:seo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     STM14_1184 (sodC_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ACY87678
UniProt: A0A0F6AZK4
LinkDB All DBs
Structure
PDB: 

Position
complement(1088397..1088930)
Genome map
AA seq 177 aa AA seqDB search
MKYTILSLVAGALISCSAMAENTLTVKMNDALSSGTGENIGEITVSETPYGLLFTPHLNG
LTPGIHGFHVHTNPSCMPGMKDGKEVPALMAGGHLDPEKTGKHLGPYNDKGHLGDLPGLV
VNADGTATYPLLAPRLKSLSELKGHSLMIHKGGDNYSDKPAPLGGGGARFACGVIEK
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacacaatattgtcgctggtagctggtgcgctcatcagttgttcagcaatggca
gagaataccctgactgtaaagatgaacgatgccctgtccagcggaacaggagaaaacata
ggtgaaatcacagtttcagagacaccttacggtctgcttttcactcctcacctaaatggt
cttacgccaggaattcacggcttccatgtccacacaaacccaagttgtatgccgggaatg
aaagacggtaaagaggttccggcgctcatggccggaggacatcttgaccccgaaaaaacc
gggaaacatcttggcccatataatgacaaagggcatttgggggatctgcctggactggtt
gtcaatgcagatggtacagccacgtatccgttactggcaccacgccttaaatcactgtca
gaactgaaaggtcactcattgatgatccataaaggcggtgacaattactccgataaacct
gctccactgggtggtggcggtgcacgttttgcctgtggtgtcattgagaaataa

DBGET integrated database retrieval system