KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_3164
Entry
STM14_3164        CDS       T01714                                 

Gene name
gogB
Definition
(GenBank) leucine-rich repeat-containing protein
  KO
K23942  Gifsy-1 prophage leucine-rich repeat protein
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Pathway
seo05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:seo00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    STM14_3164 (gogB)
SSDB
Motif
Pfam: FNIP LRR_4
Other DBs
NCBI-ProteinID: ACY89595
UniProt: A0A0F6B504
LinkDB
Position
2780529..2782022
AA seq 497 aa
MTYRLKKRMKIGFQPAILQYAYTSNEATSNLELLNKWRIESPDIEKEERNSIYDKIIEAN
HTGSLSITAHHVTSIPVFPDNLSELNLSSCYTLESIPNLPDGLKSLTISGNQTIKISYFP
DSLESLSIDMQAYEENYTFPALPYGLKSFTACYGKFLPPLPPHLSSLSLQNFSEILCAEL
PYKLDKLDLQNCPFLPLMKMLPEELKELSIELIRTVPGTVIDDILPDKLKKLSINFCDNI
KLPVKLPVNLKSINLSSRTPIAWEIPTCNLPAHIDISTDGYVKLNPEFLTRSDITFSNKP
AGDVLSFQPGDVVYGLCKARDRVNTLVNSLYYFSKKDIIIQNTLTDAVWDRKNRAVFNKD
EKIAERLNDVQRGIFFREFLSQHKKYNITEDKYSDLSNEECWIKTSKAGLEFQTRLRERS
VIFVIDNLVDAISDIANKTGKHGNSITAHELRWVYRNRHDDLVKQNVKFFLNGEAISHED
VFSLVGWDKYKPKNRNR
NT seq 1494 nt   +upstreamnt  +downstreamnt
ttgacatatagattgaaaaagcgcatgaaaataggattccaaccagccatattgcaatat
gcatatacaagtaacgaggcgacatcaaaccttgagttattaaataaatggagaatagaa
tccccagatattgagaaggaggagcgtaatagtatttacgacaaaataatagaagcaaat
cataccgggagcttatcaattactgctcatcatgttacctctattccggtatttcctgat
aatttatccgaattgaatttatcttcatgctatacactggagtctattccaaatcttcct
gatgggttaaaaagtttaactatatctggaaatcagaccattaaaatttcatatttccca
gatagcttagagtcactatctatagatatgcaggcatatgaagaaaattatactttcccc
gcattaccttatggattaaagagttttactgcatgctatggtaaatttttgcctcccctt
cctccgcatctatcttctttgtcattgcaaaatttctctgaaatattatgtgctgagtta
ccatataaattagataaattagatttacaaaattgccctttcttgccattaatgaaaatg
ttacctgaggagttaaaagaactaagtattgaacttatacgaacagttcccggtactgtt
atagatgatattttgcctgataagctaaaaaaattaagtatcaacttttgtgataatatt
aaacttccagttaagcttcctgttaatttaaagtctatcaatttatcctcaaggacccct
attgcatgggaaataccaacctgcaatctgcctgcacatatagatattagtaccgatggt
tatgttaagcttaatcctgaatttcttaccaggagtgatattacctttagtaacaaacct
gcaggagatgtgttaagttttcagcctggagatgtggtttatggtttatgtaaggcaaga
gatcgagtaaatactttagttaattcgttatattatttttcaaaaaaagatattattatt
caaaatacattaacagatgcggtctgggacaggaagaatagagccgtgtttaataaagat
gagaagatagcagaaagattgaatgatgttcagagagggattttttttagagaattttta
tctcaacataaaaaatacaatattaccgaagataaatattcagacttatccaatgaggag
tgctggataaaaacaagtaaagccggtcttgaatttcaaacacgattgagggaacggtca
gttatttttgtcattgacaatttagttgatgctataagtgatatcgcaaataaaacagga
aagcatggtaattctattacagcacatgagctaagatgggtatatcggaatcgacatgat
gatctggtaaaacaaaatgttaaattttttcttaatggtgaggctatttcacacgaagat
gttttttcattagttggttgggataaatataagcctaaaaatagaaatcgttga

DBGET integrated database retrieval system