KEGG   Seonamhaeicola sp. S2-3: BWZ22_04485Help
Entry
BWZ22_04485       CDS       T04683                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
seon  Seonamhaeicola sp. S2-3
Pathway
seon00010  Glycolysis / Gluconeogenesis
seon00020  Citrate cycle (TCA cycle)
seon00620  Pyruvate metabolism
seon01100  Metabolic pathways
seon01110  Biosynthesis of secondary metabolites
seon01120  Microbial metabolism in diverse environments
seon01130  Biosynthesis of antibiotics
seon01200  Carbon metabolism
Module
seon_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:seon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BWZ22_04485
   00020 Citrate cycle (TCA cycle)
    BWZ22_04485
   00620 Pyruvate metabolism
    BWZ22_04485
Enzymes [BR:seon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BWZ22_04485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 GCV_H PYNP_C DUF386
Motif
Other DBs
NCBI-ProteinID: APY10542
UniProt: A0A1U7DQ81
LinkDB All DBs
Position
complement(936457..938097)
Genome map
AA seq 546 aa AA seqDB search
MAIVVNMPRLSDTMEEGTVASWLKKVGDKVEEGDILAEIETDKATMEFESFNEGTLLYIG
VQEGETTKVDELLAIIGEEGEDISALLNGGDTPAEENKEAVAEPAKAETSESVTEEKQEA
ASVDIPEGVVVVTMPRLSDTMEEGTVALWVKKVGDTVEEGDILAEIETDKATMEFESFQS
GTLLYIGLQEGESAKVDELLAIIGPAGTDVSDVAKNFKSVASKEEETPKVEAPKPAAPAP
KAEAPKVETKKETPKPKKPAKSGERILASPLAKKMAEERGINLAHITGTGENGRIVKFDI
ENFVPGSSAGAVGKYVPTGQEDYEDVPNSQMRKAIAKSLTKSKFSAPHYYLAVEFDMDNA
IAFRKQFNSIPDTKISFNDMVVKACALALKEHPQVNSQWFDDKMRLNNHVHIGVAVAVPD
GLVVPVVRFANEQSLPQIGAEVKELAGKARNKKLTPDEMSGSTFTVSNLGMFGIDYFTSI
INQPNSAILSVGAIVQKPVVKEGQIVVGNTMKLTLACDHRTVDGATGAQFLQTLKGYIEN
PVTMLV
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagtagtaaatatgccacgtttaagcgataccatggaagaaggtaccgtagct
tcgtggttaaaaaaagtaggagataaagtagaagaaggtgatattttagctgaaatagaa
acagacaaagccactatggagtttgagtcttttaatgaagggactttactttatattgga
gttcaagaaggtgaaactactaaagtagacgaactattagctattattggagaagaagga
gaagatatttctgctttattaaatgggggcgatactccagctgaagaaaataaagaagca
gttgcagaacctgccaaagctgaaacttctgagtctgttaccgaagagaagcaagaagca
gcatcagttgatataccagaaggtgttgtagtagtaactatgcctcgcttaagtgatact
atggaagaaggaacggtagcactttgggttaaaaaagtaggtgatactgttgaagaagga
gatattctagccgaaattgaaacagataaggctactatggaatttgaatcattccaatca
ggtacgctgctttatattgggttacaagaaggcgaatcagcaaaagtagatgaactttta
gcaataatagggcctgccggtacagatgtttcagatgtagctaaaaactttaaatctgta
gctagtaaagaagaagaaacaccaaaagtagaagcgccaaaaccagctgcacctgcacct
aaggctgaagctcctaaagttgaaacaaaaaaggaaacaccaaaaccaaaaaaaccagct
aaatctggagaaagaatattagcgtctcctttggctaaaaaaatggccgaagaaagaggt
attaatttagctcatataacaggtactggtgaaaatggtagaatagtaaaatttgatata
gagaattttgtaccaggttcttctgcaggtgctgttggtaaatatgttccaacaggtcaa
gaagattatgaagatgttcctaattctcaaatgcgtaaggctattgctaaatcgttaact
aaatcaaaattctcagcgccacactattatttagcggtagaatttgatatggataatgct
attgctttccgtaagcaatttaactctattccagacactaagatttcgtttaacgatatg
gttgttaaagcttgtgctttagcattaaaagaacatcctcaagtaaattcacagtggttt
gatgataaaatgcgtttaaacaaccatgtacatattggggtagctgttgctgttccagat
ggtttagttgtgcctgttgtgcgttttgctaacgaacagtcattaccacaaattggtgca
gaggttaaagaattagctggtaaagcaagaaataagaaattaactccagatgaaatgtct
ggtagtacatttacagtttctaacttaggaatgtttggtatagattattttacatctatt
attaatcaaccaaattcagcaattctttctgttggagccattgtgcaaaaaccagtggta
aaagaaggtcaaattgtagtaggtaatactatgaaattaacccttgcttgcgatcacaga
actgttgatggtgccacaggtgctcaattccttcaaactttaaaagggtatattgaaaac
ccagtaacaatgctagtttaa

DBGET integrated database retrieval system