KEGG   Seonamhaeicola sp. S2-3: BWZ22_06295Help
Entry
BWZ22_06295       CDS       T04683                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
seon  Seonamhaeicola sp. S2-3
Pathway
seon00010  Glycolysis / Gluconeogenesis
seon00053  Ascorbate and aldarate metabolism
seon00071  Fatty acid degradation
seon00280  Valine, leucine and isoleucine degradation
seon00310  Lysine degradation
seon00330  Arginine and proline metabolism
seon00340  Histidine metabolism
seon00380  Tryptophan metabolism
seon00410  beta-Alanine metabolism
seon00561  Glycerolipid metabolism
seon00620  Pyruvate metabolism
seon00625  Chloroalkane and chloroalkene degradation
seon01100  Metabolic pathways
seon01110  Biosynthesis of secondary metabolites
seon01120  Microbial metabolism in diverse environments
seon01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:seon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BWZ22_06295
   00053 Ascorbate and aldarate metabolism
    BWZ22_06295
   00620 Pyruvate metabolism
    BWZ22_06295
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BWZ22_06295
   00561 Glycerolipid metabolism
    BWZ22_06295
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BWZ22_06295
   00310 Lysine degradation
    BWZ22_06295
   00330 Arginine and proline metabolism
    BWZ22_06295
   00340 Histidine metabolism
    BWZ22_06295
   00380 Tryptophan metabolism
    BWZ22_06295
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BWZ22_06295
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BWZ22_06295
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BWZ22_06295
Enzymes [BR:seon01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BWZ22_06295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh TonB_C
Motif
Other DBs
NCBI-ProteinID: APY10871
UniProt: A0A1U7DR60
LinkDB All DBs
Position
complement(1343508..1345049)
Genome map
AA seq 513 aa AA seqDB search
MKAFGLDKALQTLGILTVNNGTSTGVNSFGEGKIIKSFSPVDGQLIGNVKTTTETDYQKV
IDAATKAFKTWRLVPAPQRGDIVRQFGDKLRAKKEALGKLVSYEMGKSYQEGLGEVQEMI
DICDFAVGLSRQLHGLTMHSERPGHRMYEQYHPLGVVGIISAFNFPVAVWSWNTALAWVC
GDVCVWKPSEKTPLCGVACQNIIAEVLKENNLPEGISCLINGNYKVGEFMTKDTRIPLVS
ATGSTRMGKIVAKEVAGRLGKTLLELGGNNAIIVTPDADIKMTVIGAVFGAVGTAGQRCT
STRRLIIHESIYDKVKQAIVNAYKQIKIGNPLDETNHVGPLIDKAAVKMYEDALIKVKKE
GGTILVEGKVLSGKGYESGCYVKPAIAEAKNDFEIVQHETFAPILYLLKYSGDVTNAIDI
QNGVAQGLSSAIMTNNLREAEQFLSHAGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRE
SGSDAWKVYMRRQTNTINYTTKLPLAQGIKFNL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatttggtttagataaagcattacaaactttaggtattttaactgtaaacaac
ggtacatcaactggtgttaatagttttggtgaaggtaaaattattaaaagtttttcacct
gtagatgggcaattgataggaaatgtaaaaacaactacagaaacagattaccaaaaggtt
atagatgctgcaaccaaagcttttaaaacatggcgattagttcctgcgccacaacgcgga
gacattgtacgccaatttggagataaattaagagcaaaaaaagaagcgttaggtaaatta
gtgtcttatgaaatgggaaaaagctaccaagagggcttgggtgaagtgcaagaaatgatt
gatatctgtgattttgcagtgggtttatcgcgtcagctacacggtttaaccatgcacagt
gagcgtccagggcatcgtatgtacgagcagtatcatccgcttggggtggttggtatcatt
tctgcatttaattttccggtagccgtttggtcttggaacactgctttagcttgggtttgt
ggcgatgtttgtgtgtggaaaccaagtgaaaaaacaccgctttgtggtgttgcttgccaa
aatattattgcagaagttttaaaagaaaataatttacccgaaggtatttcatgcttaatt
aatggcaattataaagtgggtgaatttatgactaaggacaccagaatccctctagtgtct
gccactggttcaaccagaatgggtaaaattgtggcaaaagaggtagcaggcagattaggt
aaaacgttattagaattaggtggtaataacgctattattgtaacacccgacgccgatata
aaaatgacggttattggagctgtttttggtgctgttggtaccgcaggacaacgctgtaca
agtacgcgaaggttaattattcatgaaagtatttatgataaagtaaaacaagccattgtt
aatgcttacaaacaaataaaaataggaaatccgttagatgaaaccaatcacgtagggcca
ctaattgataaagctgcagtaaaaatgtatgaagatgctttaattaaagttaaaaaagaa
ggcggtactattttagttgaaggcaaagtactctcgggtaaaggttatgaaagcggttgt
tatgttaaaccagctattgcagaagctaagaatgacttcgaaattgtacaacatgaaact
tttgcccctattttatacttgttgaaatactctggagatgttacaaatgctattgatatt
caaaatggtgttgctcaaggtttgagttcggctataatgactaataatttacgtgaagcg
gaacaatttttatctcacgcaggtagcgattgcggaattgctaacgttaatataggaaca
tcgggtgccgaaattggtggcgcttttggcggtgaaaaggaaacgggtggtggtagagaa
tcgggttcagatgcttggaaagtttacatgcgtagacaaacaaatactattaattacacc
acaaaattgcccttagcacagggcataaagtttaatttataa

DBGET integrated database retrieval system