KEGG   Seonamhaeicola sp. S2-3: BWZ22_06525Help
Entry
BWZ22_06525       CDS       T04683                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
seon  Seonamhaeicola sp. S2-3
Pathway
seon00240  Pyrimidine metabolism
seon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BWZ22_06525
Enzymes [BR:seon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BWZ22_06525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: APY10914
UniProt: A0A1U7DR02
LinkDB All DBs
Position
1398484..1399131
Genome map
AA seq 215 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFARQKVEIFKPAIDVRYDEDM
VVSHDANEIRSTPVPAAANIPILADGCDVVGIDEAQFFDDEIVRVCNDLANKGIRVIVAG
LDMDFKGNPFGPMPNLMATAEYVTKVHAVCTRTGNLAQYSYRKAKNDNLVMLGEVDEYEP
LSRAAFYKAMMRDKVRNMNVNDPQEITKNPEDQDA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaatacggtaaatcataaagaacaatttggatggattgaggttatctgc
ggatctatgttttctggtaaaaccgaagagttaattagaagacttaaacgtgcccaattt
gcaagacaaaaagttgaaatttttaaacccgctattgatgtacgttatgatgaagatatg
gtagtctctcatgatgccaacgaaattagatctacacccgtgcctgctgccgcaaacata
cctattttggcagatggttgcgatgtagttggtattgatgaagcccaattttttgatgat
gaaattgttagagtttgtaatgatttagcaaacaaaggcattagagtaattgtggctggt
ttagacatggattttaaaggcaatccgtttggtcctatgcccaacctaatggctactgca
gaatatgttacaaaggtgcatgctgtatgtacacgtaccggaaatttagcccaatatagt
taccgtaaagctaaaaacgataatttggttatgcttggtgaggtagatgaatatgaacct
ttaagtagagccgcattttacaaagccatgatgcgtgataaagtaagaaatatgaatgtt
aatgacccccaagaaatcaccaaaaaccctgaagaccaagatgcctaa

DBGET integrated database retrieval system