KEGG   Staphylococcus epidermidis ATCC 12228: SE0712Help
Entry
SE0712            CDS       T00110                                 

Definition
(RefSeq) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00061  Fatty acid biosynthesis
sep00780  Biotin metabolism
sep01100  Metabolic pathways
sep01130  Biosynthesis of antibiotics
sep01212  Fatty acid metabolism
Module
sep_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SE0712
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SE0712
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SE0712
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sep01004]
    SE0712
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SE0712
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SE0712
Lipid biosynthesis proteins [BR:sep01004]
 Fatty acid synthase
  Component type
   SE0712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 1055765
NCBI-ProteinID: NP_764267
UniProt: A0A0H2VFS8
LinkDB All DBs
Position
700869..701639
Genome map
AA seq 256 aa AA seqDB search
MLNLENKTYVIMGIANKRSIAFGVAKVLDRLGAKLVFTYRKERSRKELEKLLEQLNQSEH
HLYEIDVQNDEDIINGFSQIGKDVGQIDGVYHSIAFANMEDLRGRFSETSREGFLLAQEI
SSYSLTLVAHEAKKLMPEGGSIVATTYIGGEAAVQNYNVMGVAKASLEANVKYLALDLGE
DNIRVNAISAGPIRTLSAKGVGGFNTILKEIEARAPLKRNVDQEEVGKTAAYLLSDLSSG
VTGENIHVDGGFHAIK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatctagaaaataaaacctacgtcattatgggtattgcgaataaacgtagtatc
gcatttggcgtcgctaaagtattagatcgattaggtgctaaactggtatttacatatcgt
aaagaacgcagtcgtaaagaattagagaaattattagaacaattaaatcaatctgaacat
catctctatgaaattgatgtgcagaatgatgaggatatcattaatggtttttctcaaatc
ggaaaagatgtaggccagattgatggtgtttatcactcaatcgcatttgccaatatggaa
gatttacgaggtcgattttcagaaacatctcgcgaaggtttcttacttgcacaagaaatt
agttcatattcacttactctcgtagctcatgaagccaaaaaacttatgcctgaaggtgga
agtattgttgcgacgacttatattggtggtgaggcagcagttcaaaactataatgttatg
ggtgtagctaaagcaagtttagaggcgaatgttaaatatttagctttagacttaggtgaa
gataatattcgtgtcaatgctatttctgcagggccaattcgtactttaagtgctaaaggt
gtaggtggatttaatacaattcttaaagaaattgaagcgagagcgccgttaaaacgcaac
gttgatcaagaagaagtaggtaagacggctgcgtatttattaagtgatctttcaagtggt
gtaactggagagaacatccacgttgatggtggattccacgcaattaaataa

DBGET integrated database retrieval system