KEGG   Staphylococcus epidermidis ATCC 12228: SE1097Help
Entry
SE1097            CDS       T00110                                 

Gene name
sucA
Definition
(RefSeq) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00020  Citrate cycle (TCA cycle)
sep00310  Lysine degradation
sep00380  Tryptophan metabolism
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01120  Microbial metabolism in diverse environments
sep01130  Biosynthesis of antibiotics
sep01200  Carbon metabolism
Module
sep_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sep_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SE1097 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    SE1097 (sucA)
   00380 Tryptophan metabolism
    SE1097 (sucA)
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     SE1097 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 1057037
NCBI-ProteinID: NP_764652
UniProt: Q8CP83
LinkDB All DBs
Position
complement(1108145..1110949)
Genome map
AA seq 934 aa AA seqDB search
MTKNKKEFTEAPVNFGANLGLMLDLYDDYLQDPSSVPEDLQVLFSTIKTGEAHIEAKPTT
DGGGSQAGDSTIKRVMRLIDNIRQYGHLKADIYPVNPPERQNVPKLEIEDFDLDKETLEK
ISSGIVSEHFKDIYDNAYDAIVRMERRYKGPIAFEYTHINNNKERVWLKRRIETPYKASL
NDNQKKELFKKLAHVEGFEKYLHKNFVGAKRFSIEGVDTLVPMLQHTITLAGNEGIKNIQ
IGMAHRGRLNVLTHVLEKPYEMMISEFMHTDPMKFLPEDGSLELTSGWTSDVKYHLGGVK
TTNSYGIEQRISLANNPSHLEIVAPVVAGKTRAAQDNTHQVGAPSTDFHKAMPIIIHGDA
AYPGQGINFETMNLGSLKGYSTGGSLHIITNNRIGFTTEPIDGRSTTYSSDVAKGYDVPI
LHVNADDVEATIEAIEIAMEFRKEFHKDVVIDLVGYRRYGHNEMDEPSITNPVPYQNIRK
HDSVEILYGKKLVDEGIISEDEMNEVIDGVQKEMRTAHDKIDKNDKMNNPDMEKPESLQL
PLQSDTKDFSFDHLKEINDAMLDYPKDFHVLKKLNKVLEKRREPFEKEEGLVDWAQAEQL
AFATILQDGTSIRLTGQDSERGTFSHRHAVLHDEENGNTFTPLHHVPQQQATFDIHNSPL
SEAAVVGFEYGYNVENKGNFNIWEAQYGDFSNMSQMMFDNFLSSSRAKWGERSGLTLFLP
HAFEGQGPEHSSARLERFLQLAAENNSTVVNLSSASNYFHLLRAQAASLDTLEMRPLIVM
SPKSLLRNKTVAKPIDEFTSGGFKPIITEDIDEQKVKKVILASGKMYIDLKEYLAKNPND
SILLIAVERLYPFPEEEIKEVLKSLPHLENVSWVQEEPKNQGAWLFVYPYLKALVANKYD
LTYHGRIQRAAPAEGDGEIHKLVQTKIIESSINN
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atgactaagaacaagaaagaatttacagaggctcctgtaaacttcggcgcaaatcttggc
cttatgctagatttgtatgatgattatctacaagatccatcatccgtacctgaagattta
caagtcttgttcagtacaattaaaacaggtgaagctcatatcgaagctaaacctaccact
gatgggggtggttcacaagcgggagatagcacaattaaacgtgttatgcgcttaatcgat
aatattcgtcaatacggacatttaaaagcagatatttatccagtaaatcctccagagcgt
caaaatgttcctaaattggaaatcgaagattttgatttagataaagaaactttggaaaaa
atatcatctggaattgtctctgaacattttaaagacatttatgacaatgcctatgatgca
attgttcgtatggaaagacgttacaaaggaccgatagcttttgaatacactcacattaat
aataataaagaacgtgtgtggttaaaaagaagaattgaaacgccttataaagcaagttta
aacgataatcaaaaaaaagaacttttcaaaaaactcgcacacgtagaaggttttgaaaaa
tatttgcacaaaaattttgttggggctaaacgtttttcaattgaaggcgtcgacacatta
gttccaatgcttcaacacacaatcacattagcaggtaacgaggggattaaaaacattcaa
atcggtatggctcaccgtggacgtttaaatgtattaacgcatgtcttggaaaaaccttat
gagatgatgatttcagaatttatgcatacagatccaatgaagtttttacctgaagatggt
agtttagaattaacctcaggttggacttcagatgtgaagtatcacctaggtggcgttaaa
acgactaactcatacggaatagaacagcgtatttctttagcgaataatccaagtcattta
gaaatcgttgcacccgttgttgctggtaaaacaagagcagcccaagataatacacatcaa
gtaggagctccatctaccgacttccataaagcaatgccgattattatacatggtgatgcg
gcatatccaggtcaaggtattaattttgaaacgatgaacttaggtagtttaaaaggatat
tctacaggtggttcacttcatattattacaaataatagaatcggttttacaactgaacct
attgatggacgttcaacaacgtactcttccgacgtagctaaaggttacgatgttccaata
ctacatgtaaatgccgatgatgtagaagcaacaattgaagctattgaaattgcaatggaa
ttccgtaaagaatttcataaagatgtcgttattgacttagtaggttatcgtcgctatggg
cacaatgaaatggatgaaccttctattactaatccagttccataccaaaacattagaaaa
catgattcagttgaaattttatatggtaaaaagttagttgatgaaggaattatttccgaa
gacgaaatgaatgaagtcattgacggtgttcaaaaagaaatgcgaacagcacatgataaa
attgataaaaatgacaaaatgaataatccagatatggaaaaaccagaatcacttcaacta
cctttacaaagtgatacgaaagatttctcatttgatcatttaaaagaaatcaatgatgca
atgcttgattacccaaaagattttcatgtgctaaaaaagctcaataaagtactagaaaaa
cgtagagaaccttttgaaaaagaggaggggctcgtcgattgggctcaagcagagcaactt
gcatttgcaaccatattacaagatggaacttcaattcgtttaacaggtcaagatagtgaa
aggggaacatttagccatagacatgctgtgcttcatgatgaagaaaatggtaatacattc
acaccattgcatcatgtacctcaacaacaggctacttttgatattcataattcgccatta
tctgaagcagctgtagttggatttgagtatggttataacgtcgaaaataaaggtaacttt
aacatatgggaagctcaatatggcgacttttcgaatatgtcccaaatgatgtttgacaat
ttcctctcaagttctcgcgcaaaatggggtgagcgttcaggtttaacacttttcttacca
catgcttttgaaggacagggaccagagcattcatcggcacgcttagaaagatttctacaa
ttagccgctgaaaataattcaactgtagttaatctatctagtgcaagtaattacttccat
ttactacgtgcacaagccgctagtttagataccttagaaatgagaccattaattgtcatg
tcacctaagagtcttttaagaaataaaacagtagctaaacctattgatgagtttacatct
ggcggttttaaacctatcatcacagaagatatcgatgaacaaaaagtcaaaaaagtgatt
ttagcatcaggaaagatgtatattgacctaaaagaatatttagctaaaaatcctaacgat
tctattcttctcatagcagtagaaagattatatccgttcccagaagaagaaattaaagaa
gtattaaaatcgttacctcatcttgaaaatgtgtcatgggttcaagaagaacctaaaaat
caaggtgcatggttattcgtgtatccttatctaaaagcacttgttgctaataaatatgat
ttaacttatcacggtagaatacaaagagctgcacctgctgaaggcgatggagaaattcat
aaacttgtacaaactaaaattattgaaagtagcattaacaattaa

DBGET integrated database retrieval system