KEGG   Staphylococcus epidermidis ATCC 12228: SE1681Help
Entry
SE1681            CDS       T00110                                 

Gene name
ddl
Definition
(RefSeq) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00473  D-Alanine metabolism
sep00550  Peptidoglycan biosynthesis
sep01100  Metabolic pathways
sep01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sep00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SE1681 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SE1681 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SE1681 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sep01011]
    SE1681 (ddl)
Enzymes [BR:sep01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SE1681 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:sep01011]
 Precursor biosynthesis
  Amino acid ligase
   SE1681 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 DUF4343 IF3_N
Motif
Other DBs
NCBI-GeneID: 1057001
NCBI-ProteinID: NP_765236
UniProt: Q8CRP5
LinkDB All DBs
Position
complement(1738930..1740003)
Genome map
AA seq 357 aa AA seqDB search
MTKENICIVFGGKSAEHDVSILTAQNVLNAIDKERYQVDIIYITNDGEWKKKDNITQEIK
NTDELVINDVETGEISQLLSKGSLGKSYDAVFPLLHGPNGEDGTIQGLFEVLDIPYVGNG
VLAASSSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYENNIIKLVNDKLTYPVFVKPAN
LGSSVGISKCNNEEELKSGITEAFQFDRKLVIEQGINAREIEVAVLGNDYPETTWPGEVV
KDVAFYDYKSKYKDGKIRLDIPADLDQDVQMTLRNMALEAFKATDCSGLVRADFFVTDDN
QIYINETNAMPGFTAYSMYPNLWKNMGLSYPDLIAKLIDLAKERYEDKKKNKYKIDY
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaaaatatttgtatcgtttttggaggtaaaagtgcagaacacgatgtttca
attttaactgcacaaaatgttttaaacgcaattgataaagaacgatatcaagttgatatc
atttatataacaaacgatggtgaatggaagaaaaaagataatattacacaagaaataaaa
aatactgatgaactcgtcattaacgatgtagagactggagaaatctcacagttactcagt
aaaggtagtttaggaaaatcatatgatgcagtattcccattattgcatggtccaaatgga
gaagatggaactatccaaggtctttttgaagtacttgatataccatatgtaggtaatggt
gtgttagctgcttcaagctcaatggataaacttgtgatgaaacaattatttgagcataga
ggtttacctcaattaccttatattagctttttaagaagtgagtatgaaaaatatgaaaat
aatatcattaaattagttaatgataagttaacatatccggtatttgtaaaacctgctaat
ctcggttcaagtgttggtataagtaaatgtaacaatgaagaagaattaaaatctgggata
actgaagcattccaatttgatcgtaaacttgtcattgaacaagggattaatgctagagag
atcgaagtagctgtcttaggtaacgattatcctgaaacgacatggcctggtgaggttgtt
aaggatgtagcgttttatgattataaatcaaagtataaagacggtaagattagattagat
attccagcagatttagatcaagatgttcaaatgacattaagaaacatggcattagaggcc
tttaaagctactgattgttcgggattagttcgtgcagatttctttgttactgatgataat
caaatttatatcaatgaaacaaatgccatgccaggatttactgcatatagtatgtatcca
aacttatggaaaaatatgggcttatcttaccctgatttaattgctaaattgattgatttg
gctaaagaacgttatgaagataaaaagaaaaataaatataaaattgattattag

DBGET integrated database retrieval system