KEGG   Staphylococcus epidermidis ATCC 12228: SE1720Help
Entry
SE1720            CDS       T00110                                 

Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00010  Glycolysis / Gluconeogenesis
sep00071  Fatty acid degradation
sep00280  Valine, leucine and isoleucine degradation
sep00310  Lysine degradation
sep00330  Arginine and proline metabolism
sep00340  Histidine metabolism
sep00380  Tryptophan metabolism
sep00410  beta-Alanine metabolism
sep00561  Glycerolipid metabolism
sep00620  Pyruvate metabolism
sep00625  Chloroalkane and chloroalkene degradation
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01120  Microbial metabolism in diverse environments
sep01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE1720
   00053 Ascorbate and aldarate metabolism
    SE1720
   00620 Pyruvate metabolism
    SE1720
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SE1720
   00561 Glycerolipid metabolism
    SE1720
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SE1720
   00310 Lysine degradation
    SE1720
   00330 Arginine and proline metabolism
    SE1720
   00340 Histidine metabolism
    SE1720
   00380 Tryptophan metabolism
    SE1720
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SE1720
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SE1720
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SE1720
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SE1720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra Sec1
Motif
Other DBs
NCBI-GeneID: 1057384
NCBI-ProteinID: NP_765275
UniProt: Q8CNI5
LinkDB All DBs
Position
complement(1771012..1772439)
Genome map
AA seq 475 aa AA seqDB search
MRNFTKQYINGEWVDSASGETIDVINPATEEVMGKIAKGNEEDVNKAVDAADKVYLEFRH
SSVEERRELLDKIVKEYQNRKNDLIEAITDELGAPLSVSENVHYQMGLNHFTAARDALDS
FQFEEQRGDDLVVKEAIGVAGLVTPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAI
ILAEIFDKVGVPKGVFNLVNGDGSGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDVEEAANATTKKVVNNTGQVCTAGTRVLIPESIKEDYLTAVK
EAFSKVKVGQPREEGTQVGPIISKKQFDQVQDYIDKGINEGAELFYGGPGKPEGLDKGYF
ARPTIFINVDNHMTIAQEEIFGPVMSVITYNNLDEAIEIANDTKYGLAGYVIGKDKDTLR
HVARSIEAGTIEINEAGRKPDLPFGGYKESGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatttcactaaacaatatataaacggtgaatgggttgatagtgcaagcggtgaa
actattgatgttattaaccctgcaactgaagaagtaatgggtaaaattgctaaaggtaac
gaagaagatgttaataaagctgtagatgctgcagataaagtatatttagaatttagacat
agttctgttgaagaaagaagagaacttttagataaaatcgtaaaagaatatcaaaataga
aaaaatgatttaattgaagcaattactgatgaactaggagcgcctttatcagtttccgag
aacgttcattatcaaatgggattgaatcattttacagctgcaagagatgctttagatagc
ttccaatttgaagaacaacgtggcgatgatttggttgttaaagaagcaattggagttgct
ggacttgttacaccttggaatttccctacaaaccaaacttcacttaaattagctgctgcg
tttgctgctggtagccctgttgttttaaaaccatctgaagaaacaccatttgctgcaatt
attttagcagaaatttttgataaagtaggcgtacctaaaggtgtgtttaacttagtcaat
ggtgatggatctggagtaggaaatcctttaagtgaacatccaaaagtaagaatgatgtca
tttacaggttctggtcctacaggttcaaaaattatggaaaaagctgcaaaagacttcaaa
aaagtgtctcttgaattgggtgggaaatcaccttatatcgtattagatgacgttgatgtt
gaagaagctgctaatgcaacaacgaaaaaagtagttaacaatacaggtcaagtttgtact
gcaggaacacgtgtacttattcctgaaagtattaaagaagactacttaacagcagttaaa
gaagcatttagtaaagttaaagtaggtcaaccaagagaagaaggaactcaagtaggtcct
attattagtaaaaaacaatttgatcaagttcaggattacattgataaaggtatcaatgaa
ggagcagagttattctacggtggtccaggtaaaccagaaggattagataaaggatatttt
gcgcgtccaactatatttattaatgtagataatcacatgacgattgcacaagaagaaatt
ttcggacctgtcatgtctgtaatcacttataataatcttgacgaagctattgaaattgct
aatgatactaaatatggtcttgctggctatgttattggtaaagataaagatacattgaga
catgttgctcgttcaatcgaagctggtacaattgaaattaatgaagctggtagaaaacca
gacttaccattcggtggttataaagaatctggcttaggtcgtgaatggggcgattatggt
atcgaagaattcttagaagtaaaatcaatagctggatattttaaataa

DBGET integrated database retrieval system