KEGG   Staphylococcus epidermidis ATCC 12228: SE2358Help
Entry
SE2358            CDS       T00110                                 

Definition
(RefSeq) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
KEGG Orthology (KO) [BR:sep00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SE2358
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SE2358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like Thi4 AlaDh_PNT_C NAD_binding_8 FAD_binding_3 DAO K_oxygenase Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 1056715
NCBI-ProteinID: NP_765913
UniProt: Q8CMQ1
LinkDB All DBs
Position
2440012..2441535
Genome map
AA seq 507 aa AA seqDB search
MLNADLKQQLQQLLELMEGDVEFVASLGSDDKSNELKELLNEIAEMSAHITITEKSLKRT
PSFSVNRPGEETGITFAGIPLGHEFNSLVLAILQVSGRAPKEKQSIIDQIKGLEGPFHFE
TFVSLTCQKCPDVVQALNLMSVINPNITHTMIDGAVFREESENIMAVPAVFLDGQEFGNG
RMTVQDILTKLGSTQDASEFNDKDPYDVLIVGGGPASGSAAIYTARKGLRTGIVADRIGG
QVNDTAGIENFITVKETTGSEFSSNLAEHIAQYDIDTMTGIRATNIEKTDSAIRVTLEND
AVLESKTVIISTGASWRKLNIPGEDRLINKGVAFCPHCDGPLFENKDVAVIGGGNSGVEA
AIDLAGIVKHVTLFEYASELKADSVLQERLRSLPNVDIKTSAKTTEVIGDDYVTGISYED
MTTGESQVVNLDGIFVQIGLVPNTSWLQNAVELNERGEVMINRDNATNVPGIFAAGDVTD
QKNKQIIISMGAGANAALNAFDYIIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgctgatttaaagcaacaattacaacaattacttgagcttatggaaggcgac
gttgaattcgttgccagcctaggctctgatgataaatcaaacgaactcaaagaattatta
aatgagattgctgagatgtcagcacacataacaataactgaaaaatctttaaaacgtaca
ccaagtttttcagttaatcgccctggtgaagaaacaggtattacattcgctggcatacct
ttaggccatgaattcaactctttagtattagctatactacaagtgagtggtcgcgcacct
aaagaaaagcaatccattatcgatcaaattaaagggctcgaaggtccatttcatttcgaa
acctttgtaagtcttacttgtcaaaagtgtcctgacgtcgttcaagcattaaacctaatg
agtgttattaatcctaacattactcatactatgattgatggcgctgttttccgtgaagaa
tctgaaaacattatggcagttcctgccgtcttcttagatggtcaagaatttggtaatgga
cgcatgacagttcaagatattttaactaaattaggaagcacgcaagatgcctctgaattc
aacgataaagatccttatgacgtgttaatcgttggtggcggacctgcaagtggtagtgct
gcaatttatacagcacgtaaagggctacgtacaggtattgtcgctgatcgaattggtggt
caagttaatgatactgctggtatcgagaacttcatcactgttaaagaaacgacaggttca
gagttctcatcaaatcttgcagaacatattgcacaatatgatattgatacaatgactggt
attcgtgctacaaatatcgaaaaaacagattcagctattcgcgtaactttagaaaatgat
gctgttttagaaagtaaaactgtcatcatttccacaggtgcaagttggcgtaaactaaac
atcccaggcgaagaccgtctaatcaataaaggcgtggctttctgccctcactgtgacgga
cctttatttgaaaataaagatgttgctgtcatcggtggtggtaactctggtgtagaagca
gctattgatttagccggcatcgttaaacacgtaacattatttgaatacgcttctgaatta
aaagctgatagcgtattacaagaacgtttacgctcactacctaatgttgatattaaaacg
agtgctaaaacaacagaagtaattggtgacgattacgttacaggtattagctatgaagat
atgactaccggagagtcacaagtagttaatttagatggaatatttgtacagattggatta
gttcctaatacatcttggttgcaaaatgctgtcgaattaaatgaacgtggcgaggttatg
attaatcgcgataacgcaacaaacgttcctggtatctttgcagctggtgacgttaccgat
caaaaaaataagcaaataattatttctatgggtgctggtgctaatgccgcacttaatgca
ttcgattatataattagaaattaa

DBGET integrated database retrieval system