KEGG   Staphylococcus epidermidis PM221: SEB_00769Help
Entry
SEB_00769         CDS       T03289                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sepp  Staphylococcus epidermidis PM221
Pathway
sepp00010  Glycolysis / Gluconeogenesis
sepp00020  Citrate cycle (TCA cycle)
sepp00620  Pyruvate metabolism
sepp01100  Metabolic pathways
sepp01110  Biosynthesis of secondary metabolites
sepp01120  Microbial metabolism in diverse environments
sepp01130  Biosynthesis of antibiotics
sepp01200  Carbon metabolism
Module
sepp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sepp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SEB_00769
   00020 Citrate cycle (TCA cycle)
    SEB_00769
   00620 Pyruvate metabolism
    SEB_00769
Enzymes [BR:sepp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SEB_00769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_3 DUF896 ATP-synt_ab_Xtn HTH_17 Macoilin DUF719
Motif
Other DBs
NCBI-ProteinID: CDM13329
LinkDB All DBs
Position
768986..770287
Genome map
AA seq 433 aa AA seqDB search
MAFEFRLPDIGEGIHEGEIVKWFIKAGDTIEEDDVLAEVQNDKSVVEIPSPVSGTVEEVL
VDEGTVAVVGDVIVKIDAPDAEEMQFKGHGDDEDSKKEEKEQESPVQEEASSTQSQEKTE
VDESKTVKAMPSVRKYARENGVNIKAVNGSGKNGRITKEDIDAYLNGGSSEEGSNTSAAS
ESTSSDVVNASATQALPEGDFPETTEKIPAMRKAIAKAMVNSKHTAPHVTLMDEIDVQEL
WDHRKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEVVHKHYWNIGIA
ADTDKGLLVPVVKHADRKSIFEISDEINELAVKARDGKLTSEEMKGATCTISNIGSAGGQ
WFTPVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIK
RLLNNPELLLMEG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttagattacccgatatcggggaaggtatccacgaaggtgaaattgtt
aaatggtttattaaagccggcgatacaattgaagaagatgatgtattagcagaagttcaa
aatgataaatctgtagtagaaattccttctccagtaagtggtactgttgaagaagtgtta
gtagatgaaggaacagtggcagtagtaggagatgtcatcgttaaaattgatgcacctgat
gcagaagaaatgcaatttaaaggtcatggcgatgatgaggattctaagaaagaagaaaaa
gaacaagaatcaccagtgcaagaagaagcttcatcaactcaatcacaagaaaagacagaa
gtagatgaaagtaaaactgttaaagcgatgccgtcagtgcgtaagtatgcacgtgaaaat
ggtgtcaatattaaagctgtaaatggttctggtaaaaatggacgaatcacaaaagaagac
atcgatgcatacttaaatggtggtagttccgaagaaggttcaaacactagcgcagcatct
gaatcaacttctagtgatgtcgttaatgcttctgcaacacaagcattaccagaaggcgac
ttccctgaaactacagaaaaaatacctgcaatgcgcaaagcaattgctaaagcaatggtt
aattctaaacacactgcacctcatgttacattaatggatgaaattgatgtgcaagaatta
tgggatcaccgtaagaaatttaaagaaattgctgctgaacaaggtacaaaacttactttc
ttaccatatgttgttaaagcattagtttctgcacttaaaaaatatccagcacttaatact
tctttcaatgaagaagctggagaggttgtacacaaacattactggaatattggtattgct
gcagatacggataaaggattattagtaccagtagttaaacatgccgatcgtaaatcaata
ttcgaaatttctgatgaaattaatgaactagctgtaaaagcacgtgatggtaaattaact
tcagaagaaatgaaaggtgcaacatgcacaattagtaatatcggttccgctggtggacaa
tggttcactccagttatcaatcacccagaagtagctatcttaggaattggccgtatcgct
caaaaacctatcgttaaagatggagaaattgtagctgcaccagtgttagctttatcatta
agctttgaccatagacaaatcgatggtgctactggacaaaatgctatgaatcacattaaa
cgcttattaaataatccagaattattattaatggaggggtaa

DBGET integrated database retrieval system