KEGG   Staphylococcus epidermidis PM221: SEB_02002Help
Entry
SEB_02002         CDS       T03289                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sepp  Staphylococcus epidermidis PM221
Pathway
sepp00010  Glycolysis / Gluconeogenesis
sepp00260  Glycine, serine and threonine metabolism
sepp00680  Methane metabolism
sepp01100  Metabolic pathways
sepp01110  Biosynthesis of secondary metabolites
sepp01120  Microbial metabolism in diverse environments
sepp01130  Biosynthesis of antibiotics
sepp01200  Carbon metabolism
sepp01230  Biosynthesis of amino acids
Module
sepp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sepp_M00002  Glycolysis, core module involving three-carbon compounds
sepp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sepp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SEB_02002
  09102 Energy metabolism
   00680 Methane metabolism
    SEB_02002
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SEB_02002
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sepp04131]
    SEB_02002
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sepp04147]
    SEB_02002
Enzymes [BR:sepp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SEB_02002
Membrane trafficking [BR:sepp04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SEB_02002
Exosome [BR:sepp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SEB_02002
  Exosomal proteins of melanoma cells
   SEB_02002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CDM14537
LinkDB All DBs
Position
complement(2033065..2033751)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWADVKLSKQGIEEAQSAGKKIYGNQIEIDIAFTSLLTR
ALETTQYILAGSDQQWIPVYKSWRLNERHYGGLQGLNKDDARKKWGEDQVHQWRRSYDVR
PPRESEEQREAYLKNRRYQHIDHRMMPYCESLKDTLERVVPFWTDHISQHLLDDKTVLVS
AHGNSIRALIKYLEGLSEEDIVGYEIKTGAPLVYELTDDLVVKDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaatactatgtcggcacggacaaagtgaatggaatgcgaaaaatttattt
acaggttgggccgatgtcaaactatcaaaacaaggaattgaagaggcgcaatcagcaggt
aaaaaaatttacggcaatcaaattgaaattgatattgcgtttacctctttactcactaga
gctttagaaacaacacaatatattttagcaggttctgaccaacagtggattcctgtttat
aaaagttggcgtttaaatgaacgacattatggtggtttacaaggtttaaataaagatgat
gcgagaaaaaaatggggggaagatcaggtgcatcaatggagacgctcatatgatgtacgt
ccgcctagagaaagtgaagaacaacgagaagcatatttaaaaaatcgtcgttatcaacat
attgatcaccgtatgatgccttattgtgaaagtttgaaagatacattagaacgagttgtt
ccgttctggactgatcatatttcacaacacctattagatgataaaactgtacttgtttcg
gcccacggaaattccattcgcgcattaattaagtatttggaaggtttatcagaagaagat
atcgtcggatatgaaattaaaacgggtgcaccgctagtatatgaactcacagatgattta
gttgttaaggataaatattatttataa

DBGET integrated database retrieval system