KEGG   Staphylococcus epidermidis PM221: SEB_p102468Help
Entry
SEB_p102468       CDS       T03289                                 

Definition
(GenBank) Accumulation associated protein Aap
  KO
K14195  surface protein G
Organism
sepp  Staphylococcus epidermidis PM221
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SasG_E G5 YSIRK_signal Gram_pos_anchor
Motif
Other DBs
NCBI-ProteinID: CDM15051
LinkDB All DBs
Position
p1:44401..50082
Genome map
AA seq 1893 aa AA seqDB search
MKKRLDFMPNKQNKYSIRRFTVGTASILVGATLFLGIGNEAKADELVNQSSENKVETNQN
AEDASELTKAPEQETSETQASKSTTAPEGKAVDENQSEQSTENSKEINNEKEETEEANKS
TEQVTPETQASKSTTAPEGKAVNENQSEQSTENSKEMNNEKEETEEANKSTEQVTPETQA
SKSTTAPEKKTVDENQSEQSIENSKEINNAKEEAEEANKSTEQVTPETQASKSTTAPEEK
TVDENQSEQETSEVQAPKSLLATSKEDTSSESPQRSALSKDSTSTYGTKPRSVSNSTNDD
TKKEASTSQSQAKQVGNWDEYIAAMNDKSVSNIQLTDDISANKNGELNANTGRAVSINGD
GHTLDTSKYYVNAPANSGNWDITLKNADLKTNNNKGFINFEPNTSGENTLTLKDVNHKGS
NIVDNKANSNLTVNLKGKVNSESNDNSKDRATIGAKNINIDSRSTVDFTRNGLGNALQVF
NDGAITSGKNATINIDVSPSDPWKVSNGNTAFKLGNNSKVQLGDNSKTDVKGQNIFDFGN
GGTLNTGIGSTVKVDQKGNGNIVNMGTDSTFEVAENSKFIANSDGHRIGDWKNDNLIGLD
GNSQILVDKEAKLLLDAKNHQWDPDKKKQVGAYNDLVNINARGNQTALLHVADNATLDLR
TDNRDYYAEVISIPLSGSNENRRYVFDDAYYVNLQKTSKVTSGESKNGEKPNLIFMDPKS
PGYFQWNGSYTVKSWDPKHYSSSDQHADADDVWDNVVDLKAQQDGFETGVPTYNKEKSTL
ESTSGKSLNELNLNHAQRLVLISNNSDNPEVHPETKTEDIPFDTKRKFDPDLKPGEERVV
QKGEKGTKTITTPNDGGKPTEKITKDPMDEIVHFGGEEIKPGHKDVFDPNAPVDSKGDIP
GKPGIKNPETGETVKEPKDSITKYGPKAGEPETKTEDIPFDKKRKFNPDLKPGEERVVQK
GEKGTKTITTPTTINPITGEKVGEGKPTEKITKDPVDEITEFGGEEIKPGHKDVFDPNAP
VDSKEDIPGKPGIKNPETGETVKEPKDSITKYGPKAGEPETKTEDIPFDKKRKFNPDLKP
GEERVVQKGEKGTKTITTPTTINPITGEKVGEGKPTEKITKDPVDEITEFGGEEIKPGHK
DVFDPNAPVDSKEDIPGKPGIKNPETGETVKEPKDSITKYGPKAGEPETKTEDIPFDKKR
KFNPDLKPGEERVVQKGEKGTKTITTPTTINPITGEKVGEGKPTEKITKDPVDEITEFGG
EEIKPGHKDVFDPNAPVDSKEDIPGKPGIKNPETGETVKEPKDSITKYGPKAGEPETKTE
DIPFDKKRKFNPDLKPGEERVVQKGEKGTKTITTPTTINPITGEKVGEGKPTEKITKDPV
DEITEFGGEEIKPGHKDVFDPNAPVDSKEDIPGKPGIKNPETGETVKEPKDSITKYGPKA
GEPETKTEDIPFDKKRKFNPDLKPGEERVVQKGEKGTKTITTPTTINPITGEKVGEGKPT
EKITKDPVDEITEFGGEEIKPGHKDVFDPNAPVDSKEDIPGKPGIKNPETGETVKEPKDS
ITKYGPKAGEPETKTEDIPFDKKRKFNPDLKPGEERVVQKGEKGTKTITTPTTINPITGE
KVGEGKPTEKITKDPVDEITEFGGEEIKPGHKDVFDPNAPVDSKEDIPGKPGIKNPETGE
TVKEPKDSITKYGPKAGEPETKTEDIPFDKKRKFNPDLKPGEERVVQKGEKGTKTITTPT
TINPITGEKVGEGKPTEKITKEPIDQVVEYGPNKEYPSNPNKPGKPEQPTNNENNKSGDH
QSSHSSNKGQSQEENGMDFEFNHDKKENSIQTNEHLDKHKDLSNKAHSSSDKKQLPDTGS
NDTNNGTLIGSLLALIGSLFVFSRRKNKQNNEK
NT seq 5682 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaagattagactttatgccgaataaacaaaacaaatactcgattagaagattt
actgtaggtacagcttctattctagtaggcgctacattgtttttaggtattggaaacgaa
gcaaaagcagatgaattggtaaatcaatcaagtgaaaacaaggtagaaactaatcaaaac
gcagaggacgcaagtgaattaacaaaagcacctgaacaagagacttcagagacacaagct
tctaagtcaacaacagcaccggaagggaaagctgttgatgaaaatcaatcagaacaaagt
actgaaaactctaaagagataaataatgagaaagaagaaactgaggaagcaaacaaatca
acagaacaagtgactccagagacacaagcttctaagtcaacaacagcaccggaagggaaa
gctgttaatgaaaatcaatcagaacaaagtactgaaaactctaaagagatgaataatgag
aaagaagaaactgaagaagcaaacaaatcaacagaacaagtaactccagagacacaagct
tctaagtcaacaacagcaccggaaaagaaaactgttgatgaaaatcaatcagaacaaagc
attgaaaattctaaagagataaacaatgcgaaagaagaagctgaggaagcaaacaaatca
acagaacaagtgactccagagacacaagcttctaagtcaacaacagcaccggaagagaaa
actgttgatgaaaatcaatcagaacaagagacttcagaggtacaagctccgaaatcttta
ttagctactagcaaagaggatacttcttcagaaagcccacaaagaagtgcactttcaaaa
gattctactagtacatatggtacaaaaccaagaagtgtttctaattctacaaacgatgat
actaaaaaagaagccagtacttctcaaagccaagctaagcaagttggtaattgggatgaa
tatattgctgcaatgaatgataaatctgtttcgaatattcagttaactgatgatatttca
gctaataagaatggtgaattaaatgctaatactggccgtgcagttagtataaatggtgat
ggacacacacttgatactagcaagtattatgtgaatgctcctgcaaatagtggtaattgg
gatattacattaaaaaatgctgatttaaaaacgaataataataaaggctttattaatttt
gaacccaatacttcaggagaaaatactttaactttaaaagatgtaaatcataaaggttca
aatatagttgataataaagctaatagtaatcttactgttaatcttaaaggtaaagttaac
tctgaaagtaatgataactcaaaagatagagctactattggtgctaaaaacattaatatc
gatagcagatcaacagttgatttcacacgcaacggtttaggtaatgcacttcaagtattt
aatgacggtgctattacaagtggaaaaaatgcaactatcaatatcgatgtttctccatct
gatccttggaaagtttcaaatggtaatactgcattcaagttaggtaacaattctaaagtt
caattaggagataactctaaaacagatgtaaaaggtcaaaatatcttcgattttggtaat
ggtggaacattgaatactggtattggatcaactgttaaagttgaccaaaaaggtaatggt
aatatcgtaaatatgggtacagatagtacatttgaagttgctgaaaattctaaatttatc
gcaaattctgatggtcatcgcatcggtgattggaaaaacgataatttaattggcttagat
ggaaactctcaaatattagtagataaagaagcaaaattattattagatgctaaaaaccat
caatgggacccagataagaaaaaacaagttggtgcatataacgatttagttaatattaat
gctagagggaatcaaacagcattattacatgttgctgataatgccactttggatttacgt
acagataatagagattattatgcagaggttatttcaatacctttaagtggttcaaatgaa
aatcgtcgttatgtttttgatgatgcatattatgtcaatttacaaaaaactagcaaagtt
acaagcggagaaagtaaaaatggcgagaaaccgaatttaattttcatggatccaaaatca
ccaggatatttccaatggaatggttcatacactgttaaatcatgggatccaaaacattat
agttcatctgatcaacacgcagatgctgatgatgtatgggataacgttgtggatttaaaa
gcccaacaagatggctttgaaacaggagtgccaacatataataaagaaaaatcaacatta
gaaagtacttcaggaaaatcattgaatgaattaaatttaaatcatgcacagcgattagtt
ctaatcagtaataattcagataatcctgaagttcatccagaaacaaaaacagaagacata
ccttttgatacaaaacgtaaatttgatccagacttaaaaccaggagaagaacgcgttgta
caaaaaggtgaaaaaggaactaagacaattacaacaccgaacgacggtggtaaaccaaca
gaaaaaatcactaaagatccaatggatgaaatagttcactttggcggcgaagaaattaaa
ccaggacataaagatgtatttgatcctaatgcacctgtagatagtaagggagatattcca
ggaaaaccaggaattaaaaatccagaaacaggtgaaactgttaaagagccaaaagatagt
atcacaaaatatggtccaaaagctggggaaccagaaacaaaaacagaagacatacctttt
gataaaaaacgtaaatttaatccagacttaaaaccaggagaagaacgcgttgtacaaaaa
ggtgaaaaaggaactaagacaattacaacacctacaacaatcaatcctattaccggagaa
aaagtaggagaaggtaaaccaacagaaaaaattactaaagatccagtagatgaaatcact
gaatttggcggcgaagaaattaaaccaggacataaagatgtatttgatcctaatgcacct
gtagatagtaaggaagatattccaggaaaaccaggaattaaaaatccagaaacaggtgaa
actgttaaagagccaaaagatagtatcacaaaatatggtccaaaagctggggaaccagaa
acaaaaacagaagacataccttttgataaaaaacgtaaatttaatccagacttaaaacca
ggagaagaacgcgttgtacaaaaaggtgaaaaaggaactaagacaattacaacacctaca
acaatcaatcctattaccggagaaaaagtaggagaaggtaaaccaacagaaaaaatcact
aaagatccagtagatgaaatcactgaatttggcggcgaagaaattaaaccaggacataaa
gatgtatttgatcctaatgcacctgtagatagtaaggaagatattccaggaaaaccagga
attaaaaatccagaaacaggtgaaactgttaaagagccaaaagatagtatcacaaaatat
ggtccaaaagctggggaaccagaaacaaaaacagaagacataccttttgataaaaaacgt
aaatttaatccagacttaaaaccaggagaagaacgcgttgtacaaaaaggtgaaaaagga
actaagacaattacaacacctacaacaatcaatcctattaccggagaaaaagtaggagaa
ggtaaaccaacagaaaaaattactaaagatccagtagatgaaatcactgaatttggcggc
gaagaaattaaaccaggacataaagatgtatttgatcctaatgcacctgtagatagtaag
gaagatattccaggaaaaccaggaattaaaaatccagaaacaggtgaaactgttaaagag
ccaaaagatagtatcacaaaatatggtccaaaagctggggaaccagaaacaaaaacagaa
gacataccttttgataaaaaacgtaaatttaatccagacttaaaaccaggagaagaacgc
gttgtacaaaaaggtgaaaaaggaactaagacaattacaacacctacaacaatcaatcct
attaccggagaaaaagtaggagaaggtaaaccaacagaaaaaatcactaaagatccagta
gatgaaatcactgaatttggcggcgaagaaattaaaccaggacataaagatgtatttgat
cctaatgcacctgtagatagtaaggaagatattccaggaaaaccaggaattaaaaatcca
gaaacaggtgaaactgttaaagagccaaaagatagtatcacaaaatatggtccaaaagct
ggggaaccagaaacaaaaacagaagacataccttttgataaaaaacgtaaatttaatcca
gacttaaaaccaggagaagaacgcgttgtacaaaaaggtgaaaaaggaactaagacaatt
acaacacctacaacaatcaatcctattaccggagaaaaagtaggagaaggtaaaccaaca
gaaaaaattactaaagatccagtagatgaaatcactgaatttggcggcgaagaaattaaa
ccaggacataaagatgtatttgatcctaatgcacctgtagatagtaaggaagatattcca
ggaaaaccaggaattaaaaatccagaaacaggtgaaactgttaaagagccaaaagatagt
atcacaaaatatggtccaaaagctggggaaccagaaacaaaaacagaagacatacctttt
gataaaaaacgtaaatttaatccagacttaaaaccaggagaagaacgcgttgtacaaaaa
ggtgaaaaaggaactaagacaattacaacacctacaacaatcaatcctattaccggagaa
aaagtaggagaaggtaaaccaacagaaaaaatcactaaagatccagtagatgaaatcact
gaatttggcggcgaagaaattaaaccaggacataaagatgtatttgatcctaatgcacct
gtagatagtaaggaagatattccaggaaaaccaggaattaaaaatccagaaacaggtgaa
actgttaaagagccaaaagatagtatcacaaaatatggtccaaaagctggggaaccagaa
acaaaaacagaagacataccttttgataaaaaacgtaaatttaatccagacttaaaacca
ggagaagaacgcgttgtacaaaaaggtgaaaaaggaactaagacaattacaacacctaca
acaatcaatcctattaccggagaaaaagtaggagaaggtaaaccaacagaaaaaattact
aaagaacctatcgatcaagttgttgagtatggtccaaataaagaatatccaagtaatcca
aataaaccaggtaagcctgagcaaccaactaataatgagaacaacaaatctggtgatcat
caatctagtcattcaagcaataaaggtcagtctcaagaagagaatggaatggactttgaa
tttaatcatgataaaaaagaaaattctattcaaacaaatgaacatttggataaacataaa
gatttatccaataaagctcattcaagcagtgataaaaaacaattacctgatactggtagt
aatgatactaataacggtactttaatcggatcattattagcattaattggatcattattt
gtatttagtcgtcgtaaaaataaacaaaataacgaaaaataa

DBGET integrated database retrieval system