KEGG   Staphylococcus epidermidis SEI: DP17_1013Help
Entry
DP17_1013         CDS       T03343                                 

Definition
(GenBank) putative aldehyde dehydrogenase AldA
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
seps  Staphylococcus epidermidis SEI
Pathway
seps00010  Glycolysis / Gluconeogenesis
seps00071  Fatty acid degradation
seps00280  Valine, leucine and isoleucine degradation
seps00310  Lysine degradation
seps00330  Arginine and proline metabolism
seps00340  Histidine metabolism
seps00380  Tryptophan metabolism
seps00410  beta-Alanine metabolism
seps00561  Glycerolipid metabolism
seps00620  Pyruvate metabolism
seps00625  Chloroalkane and chloroalkene degradation
seps01100  Metabolic pathways
seps01110  Biosynthesis of secondary metabolites
seps01120  Microbial metabolism in diverse environments
seps01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:seps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DP17_1013
   00053 Ascorbate and aldarate metabolism
    DP17_1013
   00620 Pyruvate metabolism
    DP17_1013
  Lipid metabolism
   00071 Fatty acid degradation
    DP17_1013
   00561 Glycerolipid metabolism
    DP17_1013
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DP17_1013
   00310 Lysine degradation
    DP17_1013
   00330 Arginine and proline metabolism
    DP17_1013
   00340 Histidine metabolism
    DP17_1013
   00380 Tryptophan metabolism
    DP17_1013
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DP17_1013
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DP17_1013
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DP17_1013
Enzymes [BR:seps01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     DP17_1013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Zw10
Motif
Other DBs
NCBI-ProteinID: AIR83667
LinkDB All DBs
Position
complement(1036971..1038464)
Genome map
AA seq 497 aa AA seqDB search
MTNINVRNYIDESYGLFINNEFQASDSGETLTVSNPANGEDLAKVARAGKKDVDKAVQAA
HDAFDSWSKISKEERADYLLEISRRIHEKTEHLATVESLQNGKPYRETSTIDVPQAANQF
KYFASVLTTDEGSVNEIDQNTMSLVVNEPVGVVGAVVAWNFPILLASWKLGPALAAGNTV
VIQPSSSTPLSLIELAKIFQEVLPKGVVNVLTGKGSESGDAIFHHEGVDKLSFTGSTDVG
YGVAQAGAERIVPTTLELGGKSANIIFDDANLEQVIEGVQLGILFNQGEVCSAGSRLLVQ
SSIYDELLPKLKEAFENIKVGDPFDEDTKMSAQTGPEQLDKIESYIKIAEEDDKANILTG
GHRITDNGLDKGYFFEPTIIEINDNKHQLAQEEIFGPVVVVEKFDDEQEAIEIANDSEYG
LAGGIFTTDIHRALNVAKAMRTGRIWINTYNQIPAGAPFGGYKKSGIGREVYKDAIKNYQ
QVKNIFIDTSNQTKGLY
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatattaacgtaagaaattatatagatgaaagttacggcttgtttattaacaat
gaattccaagctagtgatagtggggaaacattaactgtttctaatccagctaatggtgaa
gatttagctaaagttgcacgcgctggtaaaaaagatgtagataaagctgttcaagcagct
catgatgcatttgatagttggagtaagatttctaaagaagaacgtgcagattatttatta
gaaattagtcgacgtattcatgagaaaactgaacatttagcgacggttgaatcactgcaa
aatggtaaaccctatcgtgaaacatcaacaattgatgtaccacaagcagccaatcaattt
aaatattttgctagcgttttaacaactgacgaaggttcagttaatgaaattgatcaaaat
acaatgagtttagttgttaatgaacctgttggagttgttggtgcagtagtagcatggaac
ttcccaattttattagcatcatggaaattaggaccagctttagcagcaggtaatacagta
gtaattcaaccatcatcttcaacgcctttatcattaattgaacttgctaaaattttccaa
gaagttcttcctaaaggagtagttaatgtcttaactggtaaagggtctgaatcaggagac
gctattttccatcatgaaggtgtagataagttatcatttacaggttctactgacgtgggt
tacggtgtagcacaagcaggtgctgaacgtatcgttcctacaacattagaactaggtggt
aaaagtgctaatattatctttgatgatgctaatttagagcaagtgattgaaggtgttcaa
cttggtatattatttaaccaaggtgaagtatgtagtgcaggttcaagattattagtacaa
tcatctatttacgatgaattgttgccaaaattgaaagaagcatttgaaaatattaaagtt
ggcgatccatttgatgaagatactaaaatgagtgcgcaaactggaccagaacaattagat
aaaattgaaagttatataaaaattgctgaagaagatgacaaagcgaacatcttaactggt
ggtcatcgaatcacagataacggcttagacaaaggttacttctttgagcctacaattatt
gagattaacgataacaagcatcaacttgctcaagaagaaatcttcggtccagttgtagta
gttgaaaaattcgatgatgagcaagaagctatcgaaattgcaaatgattctgagtatggt
ttagctggaggtatctttactacagatattcatcgtgcattaaatgtagctaaagctatg
agaacaggtcgtatttggattaacacttataatcaaattcctgcaggtgcgccattcgga
ggatataaaaaatcaggtattgggcgcgaagtatataaagatgctatcaaaaactatcaa
caagttaaaaatatctttattgatacaagcaaccaaactaaaggtttatattaa

DBGET integrated database retrieval system