KEGG   Staphylococcus epidermidis SEI: DP17_1911Help
Entry
DP17_1911         CDS       T03343                                 

Definition
(GenBank) hypothetical protein
Organism
seps  Staphylococcus epidermidis SEI
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos
Motif
Other DBs
NCBI-ProteinID: AIR82564
UniProt: A0A0U5QD81
LinkDB All DBs
Position
2005730..2007049
Genome map
AA seq 439 aa AA seqDB search
MELTIYHTNDIHSHLNEYARIQAYMAKHRPQLEHPSLYIDIGDHVDLSAPVTEATVGHKN
IELLNEAHCDIATIGNNEGMTISHDALQNLYNDADFKVICTNVIDEEGHLPHHITSSYIK
EIKGTRILFVAATAPFTPFYRALDWIVTDPLAAIKDEINAHQGEYDLLMVMSHVGIFFDE
KLCQEIPEIDVIFGSHTHHHFEHGEINNGVLMAAAGKYGYYLGEVNITIENGKIVDKIAK
IHPIETLPLVETHFEEEGRALLSKPVVNHHVNLVKRTDVVTRTSYLLAESVYEFSRADCA
IVNAGLIVNGIEADKVTEYDIHRMLPHPINIVRVRLTGKQLKQVIQKSQKQEYMHEHAQG
LGFRGDIFGGYILYNLGFIESEDRYFIGDEEIQNDKQYTLGTVDMYTFGRYFPLLKGLST
DYIMPEFLRDIFKEKLLKL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggaattaacaatatatcacacgaatgatattcatagtcatttaaatgaatatgctcgt
attcaagcttatatggcaaaacatagaccgcaacttgaacatccctcactctatatagat
ataggtgaccatgttgatttatcagcacctgtgacagaagctacggtaggacataaaaat
atagaacttttaaatgaagcacattgtgatattgcaaccattggaaataatgaaggaatg
acaatttctcatgatgctttacaaaatctatataacgacgcggattttaaagtgatttgc
acgaatgtcatagatgaagagggacatcttccacatcatattacctcttcgtatatcaaa
gaaataaaaggaacacgtattttatttgttgcagcaacggcaccgttcacacctttttat
cgagcactggattggattgttactgacccactagcggcaatcaaagatgaaatcaatgca
catcaaggtgaatatgatcttttaatggttatgagccatgtcggtatcttttttgatgaa
aagttatgccaagagattccggaaatagatgttatctttggtagtcatacgcatcatcat
tttgaacatggagaaataaacaatggtgttttgatggcagctgccggaaaatatggctat
tatttaggtgaagttaatattacgattgaaaatggaaaaatcgttgataaaatcgccaaa
attcatcctattgaaacacttcccttagtcgagacacattttgaagaagaaggaagagca
cttctaagtaaaccagtagttaatcatcatgtgaacttagtcaaaagaacagatgttgtt
acaagaacatcgtatttactggctgaaagtgtatatgagttttcaagggctgattgtgca
atcgtaaatgctggacttatagttaatggtattgaagctgataaagtgacggaatatgat
atacatcgcatgttaccccatccaatcaatattgtaagagttcgattaaccggtaaacaa
ttaaagcaagtgattcaaaaaagccaaaagcaagaatatatgcacgaacatgcacaaggt
cttggttttagaggggatatatttggaggatatattttatataatctaggctttattgag
tcagaagaccgttattttataggcgatgaagagattcaaaatgataaacaatatacgtta
ggtactgttgatatgtatacatttggaagatatttcccattgctaaaggggttatctaca
gattatattatgcctgaatttttacgtgatatttttaaagagaaattactaaaattataa

DBGET integrated database retrieval system