KEGG   Staphylococcus epidermidis SEI: DP17_2126Help
Entry
DP17_2126         CDS       T03343                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
seps  Staphylococcus epidermidis SEI
Pathway
seps00010  Glycolysis / Gluconeogenesis
seps00020  Citrate cycle (TCA cycle)
seps00620  Pyruvate metabolism
seps01100  Metabolic pathways
seps01110  Biosynthesis of secondary metabolites
seps01120  Microbial metabolism in diverse environments
seps01130  Biosynthesis of antibiotics
seps01200  Carbon metabolism
Module
seps_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:seps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DP17_2126 (pdhC)
   00020 Citrate cycle (TCA cycle)
    DP17_2126 (pdhC)
   00620 Pyruvate metabolism
    DP17_2126 (pdhC)
Enzymes [BR:seps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DP17_2126 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_3 DUF896 ATP-synt_ab_Xtn HTH_17 Macoilin DUF719
Motif
Other DBs
NCBI-ProteinID: AIR83376
UniProt: Q9L4Z1
LinkDB All DBs
Position
2229165..2230466
Genome map
AA seq 433 aa AA seqDB search
MAFEFRLPDIGEGIHEGEIVKWFIKAGDTIEEDDVLAEVQNDKSVVEIPSPVSGTVEEVL
VDEGTVAVVGDVIVKIDAPDAEEMQFKGHGDDEDSKKEEKEQESPVQEEASSTQSQEKTE
VDESKTVKAMPSVRKYARENGVNIKAVNGSGKNGRITKEDIDAYLNGGSSEEGSNTSAAS
ESTSSDVVNASATQALPEGDFPETTEKIPAMRKAIAKAMVNSKHTAPHVTLMDEIDVQEL
WDHRKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEVVHKHYWNIGIA
ADTDKGLLVPVVKHADRKSIFEISDEINELAVKARDGKLTSEEMKGATCTISNIGSAGGQ
WFTPVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIK
RLLNNPELLLMEG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttagattacccgatatcggggaaggtatccacgaaggtgaaattgtt
aaatggtttattaaagccggcgatacaattgaagaagatgatgtattagcagaagttcaa
aatgataaatctgtagtagaaattccttctccagtaagtggtactgttgaagaagtgtta
gtagatgaaggaacagtggcagtagtaggagatgtcatcgttaaaattgatgcacctgat
gcagaagaaatgcaatttaaaggtcatggcgatgatgaggattctaagaaagaagaaaaa
gaacaagaatcaccagtgcaagaagaagcttcatcaactcaatcacaagaaaagacagaa
gtagatgaaagtaaaactgttaaagcgatgccgtcagtgcgtaagtatgcacgtgaaaat
ggtgtcaatattaaagctgtaaatggttctggtaaaaatggacgaatcacaaaagaagac
atcgatgcatacttaaatggtggtagttccgaagaaggttcaaacactagcgcagcatct
gaatcaacttctagtgatgtcgttaatgcttctgcaacacaagcattaccagaaggcgac
ttccctgaaactacagaaaaaatacctgcaatgcgcaaagcaattgctaaagcaatggtt
aattctaaacacactgcacctcatgttacattaatggatgaaattgatgtgcaagaatta
tgggatcaccgtaagaaatttaaagaaattgctgctgaacaaggtacaaaacttactttc
ttaccatatgttgttaaagcattagtttctgcacttaaaaaatatccagcacttaatact
tctttcaatgaagaagctggagaggttgtacacaaacattactggaatattggtattgct
gcagatacggataaaggattattagtaccagtagttaaacatgccgatcgtaaatcaata
ttcgaaatttctgatgaaattaatgaactagctgtaaaagcacgtgatggtaaattaact
tcagaagaaatgaaaggtgcaacatgcacaattagtaatatcggttccgctggtggacaa
tggttcactccagttatcaatcacccagaagtagctatcttaggaattggccgtatcgct
caaaaacctatcgttaaagatggagaaattgtagctgcaccagtgttagctttatcatta
agctttgaccatagacaaatcgatggtgctactggacaaaatgctatgaatcacattaaa
cgcttattaaataatccagaattattattaatggaggggtaa

DBGET integrated database retrieval system