KEGG   Staphylococcus epidermidis SEI: DP17_661Help
Entry
DP17_661          CDS       T03343                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
seps  Staphylococcus epidermidis SEI
Pathway
seps00240  Pyrimidine metabolism
seps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seps00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    DP17_661 (tdk)
Enzymes [BR:seps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     DP17_661 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 zf-C4_ClpX DUF134 FliG_C
Motif
Other DBs
NCBI-ProteinID: AIR83298
UniProt: A0A0N1EF38
LinkDB All DBs
Position
complement(686684..687283)
Genome map
AA seq 199 aa AA seqDB search
MYETYHSGWIETITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRYHKEKVVSHNG
NEIEAINISTAQEILNHKLEEVNVIGIDEVQFFEDDIVNIVEKLAENGHRVIVAGLDMDF
RGEPFKPMPKLLAVSEHITKLQAVCSVCGSPSSRTQRLINGEPAKVDDPIILVGANESYE
PRCRAHHIVAPSENEKEEM
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaacgtaccattcaggttggattgaaaccataacaggaagtatgtttagtggg
aaatctgaagaacttatacgtcgcttaagacgtggaatatacgctaaacaaaaggtggtt
gttttcaaaccagcaattgatgatcgttaccataaagaaaaggtcgtctcacataatggt
aatgagatagaagcgattaatatatctacagctcaagaaattttaaatcataagctagaa
gaagtaaacgtcatcggaattgacgaagtgcaattttttgaagacgatattgtcaacata
gttgaaaaattagctgaaaacgggcatcgtgttattgtagcaggtttagatatggatttt
agaggagaaccgtttaaacctatgcccaagttgctcgcagttagtgaacatattacaaag
ttgcaagcagtatgttctgtatgtggttcaccttcgagtcgtacacaacggttaataaat
ggtgaaccggcgaaagtagatgatcccatcatattggttggtgcaaatgaaagttacgag
ccacgttgtagagcacatcatatagttgcacctagtgaaaatgagaaggaggaaatgtag

DBGET integrated database retrieval system