KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_01170Help
Entry
SZO_01170         CDS       T00871                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Brite
KEGG Orthology (KO) [BR:seq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SZO_01170
Enzymes [BR:seq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SZO_01170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like AlaDh_PNT_C Thi4 DAO Glutaredoxin Thioredoxin_4 FAD_binding_3 NAD_binding_8 FMO-like Lycopene_cycl K_oxygenase Auto_anti-p27
Motif
Other DBs
NCBI-ProteinID: CAW97764
UniProt: C0MEG7
LinkDB All DBs
Position
complement(134564..136096)
Genome map
AA seq 510 aa AA seqDB search
MALSPDIKEQLAQYLNLLESDLVLQAYLGSDDSSQKVKDFIEEIAAMSDRITVEETTLTR
QPSFKITQKGQDSGVIFAGLPLGHEFASFILALLQVSGRAPKIEQDIIDRIRAIDRPLSF
ETYVSLTCHNCPDVVQALNIMAVLNKNISHTMVEGGMFQEEVKAKGIMSVPTVFLNGEEF
TSGRATIEQLLEQIAGPLSKEAFADKGVYDVLVIGGGPAGNSAAIYAARKGLNTGLLAET
FGGQVMETVGIENMIGTLYTEGPKLMAQVEEHTKSYDVDIIKAQLATSIEKKDLVEVTLA
NGAVLKAKTAILALGAKWRSINVPGENEFKNKGVTYCPHCDGPLFEDKNVAVIGGGNSGL
EAALDLAGLAKHVYVLEFLPELKADKVLQDRAAKTDNMTILKNVATKDIVGDDHVTGLNY
IERDSNQEKHLDLEGVFVQIGLVPNTAWLKDSGISLTDRGEIIVDKYGSTNIPGIFAAGD
CTDSAYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagtcctgatattaaagagcagcttgctcaataccttaatcttttggaatct
gacttagtcctacaagcttatcttggtagtgacgatagctcacaaaaggtcaaggacttc
attgaagaaattgctgccatgtcagaccgtatcactgttgaggagactaccctaacacgt
caaccaagctttaagattacccaaaaaggtcaagacagcggagtgatctttgctggactg
cctctaggtcacgagtttgcctcctttatccttgctctattacaggtttcaggacgtgca
ccaaagattgagcaggatattattgaccgcatcagggctattgaccgtcctttaagcttt
gaaacctatgtcagcttaacgtgtcataattgcccagatgtggtccaagccttgaacatt
atggctgttcttaataagaacatttcacatactatggttgagggtggtatgttccaagag
gaagtcaaggcaaagggcatcatgtctgtgccaactgtctttttgaatggagaagaattc
acctctggtcgcgccactattgagcagctgcttgagcaaatcgcaggacctctatctaag
gaggcctttgctgataaaggagtctatgacgtccttgtcattggtggaggacctgcagga
aatagtgctgccatctatgctgctcgtaaaggcttaaatacaggtcttttggctgagacc
tttggtggtcaagtcatggaaactgtaggtatcgaaaacatgataggaaccctgtataca
gagggaccaaagcttatggcccaggttgaggagcatactaaatcctatgatgttgacatc
atcaaagcccagctggctacttcgattgagaaaaaagaccttgttgaggttactcttgct
aatggcgctgtcttgaaggctaaaacagctattctagcgcttggtgcaaaatggcgcagt
atcaatgttcctggcgaaaatgagtttaaaaataaaggagtaacctactgcccacactgt
gacggtcctctctttgaagataaaaacgttgctgttatcggtggtggtaactctggactt
gaggctgcacttgatttagctggcttagctaagcatgtctatgttcttgagttcttacct
gagcttaaggccgacaaggtgctacaggatcgcgctgctaaaacagacaatatgactatt
ctaaaaaatgttgctacaaaggatattgttggggacgatcatgtcacagggcttaactat
atcgagcgtgacagcaatcaagaaaaacatcttgaccttgaaggagtctttgtacagatt
ggcttggtaccaaatacagcttggctcaaagacagtggtatcagcttaaccgatcgtggc
gagattattgttgataaatatggttcaaccaatattccaggtatctttgccgcaggcgac
tgtacagattcagcctacaaacaaattattatttctatggggtcaggtgctactgctgct
attggagcatttgattacctgattcgtcagtaa

DBGET integrated database retrieval system