KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_04090Help
Entry
SZO_04090         CDS       T00871                                 

Gene name
stk1
Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Brite
KEGG Orthology (KO) [BR:seq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:seq01001]
    SZO_04090 (stk1)
Enzymes [BR:seq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SZO_04090 (stk1)
Protein kinases [BR:seq01001]
 Serine/threonine kinases: Other
  Bacterial family
   SZO_04090 (stk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kdo APH RIO1 Kinase-like Haspin_kinase FTA2 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: CAW98298
UniProt: C0MH33
LinkDB All DBs
Position
469749..471644
Genome map
AA seq 631 aa AA seqDB search
MIQIGKLFAGRYRILKSIGRGGMADVYLANDLILDNEDVAIKVLRTNYQTDQVAVARFQR
EARAMAELNHPNIVAIRDIGEEDGQQFLVMEYVDGSDLKKYIQDHAPLSNNEVVRIMEEV
LSAMTLAHQKGIVHRDLKPQNILLTKSGVVKVTDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATIQSDIYAMGIMLFEMLTGHIPYDGDSAVTIALQHFQKPLPSIIDENPNVP
QALENVVIRATAKKLSDRYRSTFEMSRDLMTALSYNRSRERKVVFDDVESTKPLPKVTPT
PVTAPKVSNASQASAAADARLEQTSQMDTLQKPQKKKKNGRFLGTLLKILFSFFVVGVAL
FAYLVLTKPTTVKVPDVTGSSLNAAKQVLEEAGLKVGKVHQIESDTVSEDQVVKTNPQAG
SAKRKGSSVDLYLSIGNKGFEMENYKGQDYQDVMTSLTETYGVPKSKIKIERIVTNEYPE
NTVISQSPSAGEKFNPAGKSKITLSVAVGDTVIMPMVTEYSYADAVNTLTALGIDAARIK
AYVPSSSSPTGFVQVSSPSSKAIVSGQTPYYGTQISLSEKGDISLYLYPEETRASSSSSS
SDTSAPNPSAGDTTDSSSHTELGQNDAVTTP
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgattcagattggcaagctatttgctggtcgttatcgcattctaaaatctataggccgc
ggtggtatggcggatgtttatttagcaaacgatttgattctggataatgaggacgttgcc
attaaggtcttgcggaccaattatcaaacagatcaggttgctgttgcgcgttttcaaaga
gaagcgcgagccatggctgaattaaatcaccccaatattgttgccattcgggatataggc
gaggaagacggacagcaatttttagtaatggaatatgttgatggctctgatttgaaaaaa
tacattcaggatcatgcgccattatctaacaatgaggtggtgagaatcatggaagaggtt
ctttctgccatgactctggcccaccaaaaaggaattgttcacagggatttaaagcctcaa
aacattcttttgaccaaatcaggtgttgttaaggttacagattttgggattgccgttgcc
tttgcagagaccagtctaacccagacaaattctatgctaggaagtgtgcattacctctca
cctgagcaagcgcgtggttctaaagcgacgattcaaagtgatatttacgcgatgggaatt
atgctctttgaaatgctaacagggcatattccttatgatggcgatagcgctgtgacgatt
gctttgcagcattttcaaaagccgctgccctctatcattgatgaaaatcctaatgtgcct
caagccttggagaacgtcgttattcgggctactgccaaaaagctaagtgaccgttatcgc
tcgacctttgagatgagcagggatttgatgacagcccttagctataaccgcagtcgtgag
cgtaaggttgtctttgatgatgtcgaaagcacaaagcccttgccaaaggtaacaccgact
cctgtaacagcacctaaggtatcaaatgctagtcaggcatctgcggcagctgatgctaga
cttgagcagactagccagatggatactctgcaaaagcctcaaaaaaagaaaaaaaatggg
cgttttctaggaacactcttaaaaatcttgttttccttttttgttgttggtgtggctctt
tttgcttatttggtcttgaccaagccaactacggttaaggttcctgatgtgacaggctct
agtctcaatgctgccaagcaggtcttggaggaggcgggactaaaggtcggtaaggtccat
cagattgaaagtgacacagttagtgaggatcaggtggttaagacaaatcctcaagctggc
tcagctaagcgaaaaggctccagcgttgacctttacctttcgatcggaaataaaggcttt
gagatggaaaattataagggacaggattatcaagatgtgatgaccagtctgactgagacc
tatggcgtaccaaagtcaaaaatcaagattgagcgtatcgtgacaaatgaataccctgaa
aacaccgttattagccagtctccaagcgcaggagaaaaatttaacccagctggtaaatct
aagattactctcagtgtagcagtgggtgatacggtcatcatgccaatggtaactgagtac
agctatgcagatgcagtcaatacactaacagctttaggaattgatgccgcaagaatcaag
gcctatgtaccaagctccagctctccgacaggctttgtgcaggtgagctccccaagctca
aaggcgattgtcagtgggcaaacaccgtattatggtacccagattagcctttctgaaaag
ggtgatattagcctctacctctaccctgaggagacacgtgcatcaagcagctcatcgagc
tctgatacctcggctcctaatccatcagctggagatacaacagactcaagcagtcatacc
gaattaggtcaaaatgacgctgttacaacaccgtaa

DBGET integrated database retrieval system