KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_05490Help
Entry
SZO_05490         CDS       T00871                                 

Definition
(GenBank) putative alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
seq00500  Starch and sucrose metabolism
seq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SZO_05490
Enzymes [BR:seq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SZO_05490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: CAW98541
UniProt: C0MCN4
LinkDB All DBs
Position
638352..639827
Genome map
AA seq 491 aa AA seqDB search
MSHQLLMQAFEWYLPADAKHWQRLKSSIPELQQLGVSQLWLPPAFKGTSSDDVGYGVYDL
FDLGEFDQNGTVSTKYGSKEDYLQLIAALKEANIKPIADVVLNHKANGDHKERFSVIKMN
PENRQQPLTEPYEIEGWTGFDFPGRQNTYNDFKWHWYHFTGLDYDAKANETGIYMITGDN
KGWANDELIDDEHGNFDYLMYNDLDFKHPEVIQNLQDWAKWFIETTGIEGFRLDAVKHID
SYFIQTFINDIRTQLKPDLEVFGEYWKSDQESMEDYLEATKAQFALVDVVLHMSFFNASQ
QGADFDLTTIFDGSLVASRPDLAVTFVENHDTQRGQALESTVEEWFKPLAYGLILLRQEG
KPCLFYGDYYGISGDYPQQSFKEVITKMAELRQELVYGEQVDYFDHANCIGWIFLGADQR
PQPLAVVLSNGDAGWKHMEVGQAYAGQVFCDFLDNCQETVVVDEDGWADFKVEAGSISAW
VLQKAQPKEEA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatcaactattaatgcaggcctttgaatggtatttacctgctgatgcaaagcat
tggcaaaggctgaaaagcagtattcctgagctgcagcagctaggggttagtcagctgtgg
ctaccgcctgcctttaagggcactagctctgacgatgtgggatacggtgtttacgatttg
tttgatttgggagagtttgaccaaaatgggactgtcagcacaaaatatggcagcaaagag
gattatttgcagctgattgcagccctaaaagaggcaaatataaagcctattgctgatgtt
gtgctgaaccataaggctaatggtgatcacaaggaacgcttttctgtgatcaaaatgaat
ccagagaaccgtcagcagcctctcacagagccctatgagattgaaggctggacaggcttt
gattttcccggcagacaaaatacctataatgactttaaatggcactggtatcattttacg
ggattggattatgacgccaaggctaatgaaacaggcatttacatgatcactggtgataac
aagggctgggccaatgatgagctgattgacgatgagcatggtaattttgattatctaatg
tacaatgacctggatttcaagcaccctgaggtaatccaaaatttacaggattgggccaag
tggtttattgagacaactggtattgagggctttcgtttagacgctgtgaagcatattgat
tcttattttattcagacctttatcaatgatattcgtacccagctaaagcccgatttagag
gtttttggagaatactggaagtctgatcaggaatctatggaggattacctcgaagcaacg
aaggctcagtttgctctagttgatgttgtgctgcacatgtccttttttaatgctagccag
cagggagctgattttgatttgaccactatttttgatggcagtcttgtggctagtcggcca
gaccttgctgttacctttgtggaaaaccatgacacccaaagaggacaagctctagagtca
actgttgaggaatggttcaagcccttagcctatggcctgattcttttacgacaagagggc
aagccctgtcttttttatggtgattattatggtatttctggagactaccctcagcaaagc
ttcaaggaggttatcacaaaaatggcagagctcaggcaggagctggtctatggggagcag
gttgattactttgatcatgccaattgtatcggctggatcttcttaggagctgatcagcgt
cctcagcctctggcagtcgttttgtctaatggtgatgcaggctggaagcatatggaggtt
ggtcaagcctatgctggtcaagttttttgtgatttcttagacaattgtcaggagactgtt
gttgttgatgaggatggctgggcagatttcaaggtagaggcaggctctatctcagcctgg
gtgttacaaaaagcacagccaaaagaagaagcttag

DBGET integrated database retrieval system