KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_07410Help
Entry
SZO_07410         CDS       T00871                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
seq00010  Glycolysis / Gluconeogenesis
seq00020  Citrate cycle (TCA cycle)
seq00620  Pyruvate metabolism
seq01100  Metabolic pathways
seq01110  Biosynthesis of secondary metabolites
seq01120  Microbial metabolism in diverse environments
seq01130  Biosynthesis of antibiotics
seq01200  Carbon metabolism
Module
seq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:seq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SZO_07410
   00020 Citrate cycle (TCA cycle)
    SZO_07410
   00620 Pyruvate metabolism
    SZO_07410
Enzymes [BR:seq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SZO_07410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: CAW98874
UniProt: C0MDM4
LinkDB All DBs
Position
842245..843651
Genome map
AA seq 468 aa AA seqDB search
MAVEIIMPKLGVDMQEGEIIEWKKQEGDIVSEGDILLEIMSDKTNMELEAEDSGVLLKIT
RQAGETVPVTEVIGYIGAAGESVDGPASSKKATETSVPTTSSANAVIASKEAASTAPQVA
SVANAPAFGEKVRATPAARKAALDMGITLNQVPGTGPKGRIHKEDVEGFKGAQPKATPLA
RKIAADKGVDLAAVVGTGIGGKITKEDILAMLGAAAPAVEKAPIAEEKPAKELPEGVVIK
KMSAMRKAISKGMTHSYLTAPTFTLNYDIDMTEMIALRKKLIDPIMAKTGLKVSFTDLIG
LAVVKTLMKPEHEYMNASLINDANDIELHRFVNLGIAVGLDDGLVVPVVHGADKMSLSEF
VLASKDVIKKAQGGKLKAAEMSGSTFSVTNLGMFGTKTFNPIINQPNSAILGVGATIPTP
TVVDGEIVARPIMAMCLTIDHRLVDGMNGAKFMVDLKQLMENPFELLI
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgaaattattatgccaaagctcggtgttgacatgcaagaaggcgaaatcatc
gagtggaaaaagcaggagggtgacattgtcagcgagggtgacattcttcttgaaatcatg
tcagacaagacaaatatggagcttgaagcagaggactcaggtgtgcttctaaaaatcact
cgccaggcaggtgaaacagtccctgtcactgaggttatcggctatattggtgctgcgggt
gaatctgttgatggccctgcttcaagtaaaaaagcaactgaaacttcagtaccaacaaca
tcatcagctaatgcagtaattgcttcaaaagaagcagcttcaacagcgcctcaggtagca
tcagttgccaacgctccagccttcggagaaaaggtacgcgcaacgccagctgctcgtaag
gctgccttagacatgggaattacgcttaaccaagtgccaggaacaggaccaaagggtcgt
atccacaaagaagacgttgaaggcttcaaaggagctcagcctaaggcaacgccacttgct
cgtaagatagctgccgacaagggagttgaccttgcagcggtggtcggaacaggtattggt
ggcaagattaccaaggaggatattttggcaatgcttggcgcagcagcacctgctgtagaa
aaagcacctattgctgaggaaaaacctgccaaagagcttccagagggtgttgtcattaag
aagatgtctgctatgcgtaaggctatttcaaagggcatgactcattcataccttacagca
ccaacctttacgcttaattatgacattgacatgaccgaaatgattgccttgcgtaagaag
ctgattgacccaatcatggctaagacggggctaaaggttagctttactgacttgattggt
ttagcagttgtcaaaacattgatgaagccagagcacgaatacatgaatgcgtcattgatt
aatgatgcaaatgacattgagcttcaccgctttgtcaaccttggtattgctgtaggactt
gatgatgggttagttgtgccggttgttcatggtgcagataagatgagcctctcagagttt
gtccttgcttctaaggacgttatcaaaaaggctcaaggaggcaagctaaaggctgctgaa
atgtcaggctcaaccttctccgtcacaaatcttggtatgtttggtaccaaaaccttcaat
cctattattaaccaacctaattcagctattctaggtgttggtgcaaccattccaacccca
acagtggtcgatggtgagattgtcgcacgtccaatcatggccatgtgtttgacaattgat
caccgcttggtcgatggcatgaatggtgcgaaattcatggttgatcttaaacaattgatg
gagaacccatttgagctactcatctga

DBGET integrated database retrieval system