KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_12420Help
Entry
SZO_12420         CDS       T00871                                 

Definition
(GenBank) putative phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
seq00620  Pyruvate metabolism
seq00680  Methane metabolism
seq01100  Metabolic pathways
seq01120  Microbial metabolism in diverse environments
seq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:seq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SZO_12420
  09102 Energy metabolism
   00680 Methane metabolism
    SZO_12420
Enzymes [BR:seq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SZO_12420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Pro_dh
Motif
Other DBs
NCBI-ProteinID: CAW99736
UniProt: C0MHJ2
LinkDB All DBs
Position
complement(1384511..1387294)
Genome map
AA seq 927 aa AA seqDB search
MSVKKLESYNNQEIIAEEVAILKEILESITRRMIGDEAFARIEEIIDLSEKQDYVLLEQL
IAGISNKDMELISRYFSILPLLINISEDVDLAYEINRQNNTNQDYLGKLALTIASVAEKE
NAKELLEKVTVVPVLTAHPTQVQRKTVLELTNSIHNLLRRYRDVKAGVMNQNKWYSELYR
YIDILMQTDIIREKKLKVKNEITNVMQYYNSSLIQAITALTSKYKTLAKDKGILLDNPKP
INMGMWIGGDRDGNPFVTAETLRLSATVQSEVILRFYIDKLSALYQTFSLSSALTKTSPE
VERLASLSSDQSIYRENEPYRRAFHYIQVRLAKTLQELVGQPASDQLASRMPATVGSLQS
GVTSIVTNSSDQQAPAYKTAAAFKADLVMIEQSLIAAGDSSLVEGDLQEVLQAVDIFGFF
LASIDLRQDSSVQEACVAELLKNAGMVENYSALSEEQKCEILLKELTEDPRTLSSAAVEK
SELLEKELAIYTAARELKDKLGEEVIKQHIISHTESVSDMFELAIMLKEVGLIDQRQARV
QIVPLFETIEDLDNARAIMTQYLSYDIVKSWIATNAGYQEIMLGYSDSNKDGGYLASGWT
LYKAQNELTKIGEDNDVSITFFHGRGGTVGRGGGPSYEAITSQPFGSIKDRIRLTEQGEI
IENKYGNQDVAYYNLEMLISASINRMVTRMLTNPDEIDGFRKIMDEIVEDSKRIYRELVF
DNPHFYDYFFEASPIKEVSSLNIGSRPAARKTITDISGLRAIPWVFSWSQNRIMLPGWYA
VGSAFKRFIDKEEGNLAKLQHMYDKWPFFHSLLSNVDMVLSKSNMNIAFQYAQLAESKEV
CEVFHTILDEWQLTKNVILAIAQHDELLEETPSLKQSLDFRLPYFNVLNYIQIELIKRLR
HEQLDEDYEKLIHTTINGIATGLRNSG
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagtcaaaaaattagagagctataataatcaggagattattgctgaagaggttgct
atcctaaaggaaatacttgagagcattacgcgtcgcatgattggcgatgaggcctttgca
aggattgaggaaattatagacctatctgaaaaacaagactatgtgcttttagagcaattg
atcgctgggattagcaacaaggatatggaattaatctcacgatatttttcgattcttccg
ctgctgattaatatttcagaggacgttgatttggcttatgaaatcaatcgtcaaaataat
acgaatcaagactatctgggaaagcttgctctgaccattgcttctgttgctgaaaaggaa
aatgcaaaggagctattagaaaaggtgacggtggttccggtcttgacagcccacccaaca
caggttcagcgaaaaacagttctagagttgaccaatagcattcataaccttcttcgtcgc
tatcgtgatgtcaaagcaggtgtcatgaatcaaaacaaatggtatagcgagctgtatcgc
tacattgatatcctaatgcagacagatatcattcgtgagaaaaagctcaaggtcaaaaat
gagattaccaatgtcatgcagtattacaacagctctttgattcaggcgatcacagcgctg
acaagcaagtataagacgctggccaaggacaaggggatcttgctggacaatccaaagccg
attaacatgggcatgtggatcggaggagaccgagatggcaatccttttgtcacagcagag
acactgaggctgtctgcaacagtccaaagtgaggttatcctgcgcttttacattgacaaa
ttgtcagctctttatcaaaccttttcgctgtcgtcagccttgacaaagaccagtcctgag
gtggagcgtctggccagtctatctagtgatcagtccatttatcgtgagaatgagccctac
cgcagagcttttcactacattcaggtgcgtctggccaaaaccctgcaggagctagtgggt
cagccggcctcagaccagctagcatctagaatgcctgctacggtaggctcgcttcagtcg
ggcgttacaagcattgtgaccaatagcagtgaccagcaagcaccagcctataagacagca
gcagcttttaaggctgatctggtcatgattgagcaatctctcattgcagctggggattcc
tccttggttgagggggatttgcaagaggtcctacaagcggttgatatttttggtttcttt
ttggccagtattgatctgcggcaggattctagtgtgcaggaggcctgtgttgctgagctt
ttgaaaaatgctggtatggttgagaattacagtgctttgtcagaggagcaaaaatgtgag
atcctcttaaaggagctgacagaagaccctcgcaccctctcatcggcagctgttgaaaag
tcagagctgttagaaaaggagcttgctatctatacagcggcacgtgagctcaaggataag
cttggtgaagaggtgattaaacagcacatcatttcacatacagagagtgtttctgatatg
tttgagctggctatcatgctaaaggaggttggtctcattgaccaacgtcaggcgcgcgtg
cagattgtgcctttatttgaaacgattgaggatttggataatgctagagcgatcatgaca
caataccttagctatgatattgtcaagtcttggattgctacaaatgctggctatcaagag
attatgcttgggtattcagatagcaacaaagacggtggctatttggcgtctggctggaca
ctttacaaggcgcaaaatgagctgaccaaaatcggtgaggacaatgatgtcagcatcacc
ttctttcatggtcgtggtgggactgttggacgtggtggcggcccatcctatgaggcaatc
acctcacagccatttgggtctattaaagaccgaatccgcctgactgagcagggtgagatt
attgaaaacaaatatggcaatcaagatgtggcttactacaacttggaaatgctgatttct
gcttctatcaatcgcatggtgactcgcatgctgacaaatcccgatgagattgatggcttt
aggaaaatcatggacgaaattgttgaagacagtaagcgtatttatcgagagctggttttt
gacaatccgcatttctatgactatttctttgaagccagtccgatcaaggaggtatcaagc
ttaaatattggttctcgccctgctgctcgtaaaaccattacagatatctcaggcctgcgt
gccattccttgggtattttcttggtcacaaaaccggatcatgctcccgggctggtatgca
gtaggctctgcttttaagcgttttattgataaagaagagggaaatttagccaaattacag
catatgtatgacaaatggccgttctttcattccttgctgtctaatgttgatatggtatta
tcaaaatcaaacatgaacattgcctttcaatatgcgcagttagcagaaagcaaggaagtc
tgtgaggtctttcatactattcttgatgaatggcagctgactaagaacgttattcttgct
atcgcacagcatgatgagctgcttgaggaaaccccgtccttgaagcaaagcctggatttc
cgcctaccatattttaatgtgttaaactacattcagattgagctgattaagcgtctgcgt
catgagcagctagatgaggactatgaaaagctgatccacacaaccattaatggtattgct
acaggacttcgtaattccggctaa

DBGET integrated database retrieval system