KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_15930Help
Entry
SZO_15930         CDS       T00871                                 

Definition
(GenBank) putative aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
seq00220  Arginine biosynthesis
seq00250  Alanine, aspartate and glutamate metabolism
seq00290  Valine, leucine and isoleucine biosynthesis
seq01100  Metabolic pathways
seq01110  Biosynthesis of secondary metabolites
seq01130  Biosynthesis of antibiotics
seq01210  2-Oxocarboxylic acid metabolism
seq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:seq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SZO_15930
   00290 Valine, leucine and isoleucine biosynthesis
    SZO_15930
   00220 Arginine biosynthesis
    SZO_15930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:seq01007]
    SZO_15930
Enzymes [BR:seq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SZO_15930
    2.6.1.66  valine---pyruvate transaminase
     SZO_15930
Amino acid related enzymes [BR:seq01007]
 Aminotransferase (transaminase)
  Class I
   SZO_15930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: CAX00316
UniProt: C0MEA1
LinkDB All DBs
Position
complement(1776814..1778028)
Genome map
AA seq 404 aa AA seqDB search
MKIIEKSSKLEHVAYDIRGPVLDEANRMIANGEKILRLNTGNPAAFGFEAPDEVIRDLIL
NARSSEGYSDSKGIFSARKAIMQYCQLKGFPDVDIDDIYLGNGVSELISMSLQALLDNGD
EVLVPMPDYPLWTACVSLGGGHAVHYLCDEEAEWYPDIADIKAKITERTKAIVIINPNNP
TGALYPREVLEEIVAIAREHQLIIFADEIYDRLVMDGGEHIAIASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKRHVRGYIEGLNMLANMRLCSNVLAQQVVQTSLGGRQSVDELL
LPGGRIFEQRNFIYQAINAIPGLSAVKPKAGLYLFPKIDRSMYRIDDDEEFVLQLLKQEK
VMLVHGRGFNWKEPDHFRVVYLPTVEELADVQEKITRVLKQYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataattgaaaaatcatcaaaattagaacacgtagcctacgatattcgaggtcca
gtcctggacgaggctaatcgtatgatagctaatggtgaaaagatccttcgattaaataca
ggtaatccagcagcctttggctttgaggctccagatgaggttattcgtgatttaatcctc
aatgctcgctccagcgagggctattctgatagcaaggggattttttcagcccgtaaggct
attatgcaatattgtcagctaaagggctttcctgatgttgacattgatgatatttatttg
ggaaatggtgtttcagagctgatttcgatgtctcttcaggccttactggataatggtgat
gaggtgctggtgccaatgcctgactatcccctttggacagcctgtgtcagcttaggtggc
gggcatgcggtgcattacctgtgtgatgaagaggctgaatggtatcctgatattgctgac
ataaaagccaagatcactgagcgcacaaaggctatcgtcattatcaatcccaataaccca
acaggtgctctctaccctcgagaggtcttagaggagattgttgcaattgccagagagcat
cagctcatcatttttgcagatgagatttatgatcgtttggtcatggacggtggggagcat
atcgcaattgccagccttgcacctgatgttttttgcgtgtcaatgaatgggctgtcaaaa
tcacaccgtattgccggcttccgagtgggctggatggtcttgtcaggccctaaaagacat
gtcagaggttacattgaaggcttgaacatgctggcaaatatgcgcttgtgctccaatgtc
ttggcgcagcaggtggtacagacctccttaggaggacgtcaatctgttgatgagcttttg
cttcctggtggtcgtatatttgagcaacgtaacttcatttaccaggcgatcaatgccatt
ccaggcctatcagctgtaaagcctaaggcaggcctctatttgtttccgaaaattgatcga
agcatgtaccgcattgatgatgatgaggaatttgtcctacagcttttgaagcaagaaaag
gtcatgctggtacatgggcgtggcttcaactggaaggagcctgatcattttcgcgtggtc
tatctgccaacagtagaggaactagctgacgtgcaagaaaagatcacgcgtgttctcaag
caatacaagcgctaa

DBGET integrated database retrieval system