KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_18490Help
Entry
SZO_18490         CDS       T00871                                 

Definition
(GenBank) putative pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
seq00330  Arginine and proline metabolism
seq01100  Metabolic pathways
seq01110  Biosynthesis of secondary metabolites
seq01130  Biosynthesis of antibiotics
seq01230  Biosynthesis of amino acids
Module
seq_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:seq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SZO_18490
Enzymes [BR:seq01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     SZO_18490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Shikimate_DH NAD_binding_2 GFO_IDH_MocA 2-Hacid_dh_C PDH
Motif
Other DBs
NCBI-ProteinID: CAX00767
UniProt: C0MGA0
LinkDB All DBs
Position
2051148..2051921
Genome map
AA seq 257 aa AA seqDB search
MKIGFIGVGKMATAIIQGLKHTPHEIVISGSSVQRSKEIADQLQLAYTQSHQELIDQVDF
IILGIKPQLFEAVLSSLQFKQPIMSMAAGISLDRLAQLTSTDFPLLRIMPNMNAQILQST
TALTGNDLVTADLLATAKELTNSFGTTFEIAEKDFDTFTALAGSSPAYLYLFIEAMAKAG
VKNGLPKDKALSIVSQTVLASAKNLLVSTDSPHDLIDKICSPGGTTIAGLMDLERTGLTH
SVCSAIDTTIKKAKDLS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggatttatcggtgttggcaaaatggcaactgccatcattcaaggtctaaaa
cacacaccgcacgaaatagttatctcaggctcctctgttcaacgctctaaagaaattgct
gatcagctacaattagcctacactcaatctcatcaggagctgattgatcaggttgacttc
attattctagggatcaagccacagctctttgaggccgttcttagttctctacagttcaag
cagcctatcatgtcaatggctgctggtatttccttagacagactagctcaactaacaagc
actgatttcccgctcctacgtatcatgccaaatatgaatgctcaaattctccaaagcacc
actgctttgactggtaatgacttagtaactgctgatttattagctactgctaaagagcta
accaacagctttggaacaacctttgaaatagctgaaaaggattttgatacctttactgct
ctagcagggtcaagtcctgcttatctttaccttttcatcgaagctatggcaaaggccgga
gtcaaaaatggactgcctaaagacaaggcccttagtatcgttagtcaaactgtcctagct
agcgccaagaacctgctagtcagcacagatagtccccatgatttgattgataagatctgc
agtcccggcggcacaaccattgcaggcttgatggatcttgaaagaacaggcctgacacat
tctgtctgctctgccattgacacaacgatcaaaaaagctaaagacctatcctaa

DBGET integrated database retrieval system