KEGG   Staphylococcus equorum: SE1039_17370Help
Entry
SE1039_17370      CDS       T04160                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
seqo  Staphylococcus equorum
Pathway
seqo00052  Galactose metabolism
seqo00500  Starch and sucrose metabolism
seqo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seqo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SE1039_17370
   00500 Starch and sucrose metabolism
    SE1039_17370
Enzymes [BR:seqo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SE1039_17370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 GSDH FAIM1 DUF1934
Motif
Other DBs
NCBI-ProteinID: ALM57520
LinkDB All DBs
Position
complement(1808246..1809730)
Genome map
AA seq 494 aa AA seqDB search
MAEWTRDERYQKYEDVDQQTLDDLSAKVNESKYRQTFHLQPKTGLLNDPNGLIYYDGTYY
ISHQWFPLGPVHGLKYWYTYTSKDLVHFEDVGTSLKPDTKDDSHGVYSGSAFEYNNHMYY
MYTANHRDEDWNRISTQHIAKINAEGEIEKFPKAVIAEPPFGYTQHFRDPKVFSKDGVYY
AVIGAQNEQGQGRVIQYRSTDIVNWEFQGEVHTNLDSFGYMWECPDYFNLDGYDMLLFCP
QGIDGEGERFKNIYQSGYIMGQYDIDNLTMNHGDFFELDHGFDFYAPQTFIDEHGQRVLI
GWMGLPEINYPSDVDGWAHCLTIPRVLSIEAGNLKQRPVKSLEQLRINKETALGYANKFT
RQLYPYEGRQYELIIDILENDSTEVYFEVRTSKTQTTLITYNKKEQKLTLDRSESGLLPD
PVDNTTRTTYLDTPLTQLQLFIDTSSVEIFCNDGERVMTSRIFTDDEATGIKTSTESGQV
YLKFTKYDLKDEEV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtggacaagagatgaacgttatcaaaaatatgaagacgttgatcagcaaaca
ttagatgatttatcagctaaagttaatgagtctaagtatagacaaacgtttcatttacaa
cctaaaacaggattattaaacgatcctaacggattgatatactatgacgggacgtattat
atatcacatcaatggtttccgttaggaccagtccatggcttgaaatattggtatacatac
acaagtaaggatttagtacattttgaagatgtgggaacatcattaaagccagatactaaa
gatgatagtcatggtgtttatagtggtagtgcatttgaatataataaccatatgtattat
atgtatacggcaaatcatcgcgatgaagattggaatagaatttctacgcaacatattgca
aaaataaatgcagaaggtgaaattgaaaagtttcctaaagcggtcattgctgaaccgcca
tttggatatacacagcacttcagagaccctaaagtattttcaaaagatggtgtctattat
gctgtcattggagctcaaaatgaacaaggtcaaggtagagtgattcaatatcgttcaaca
gatattgtgaattgggaatttcaaggtgaagttcatacgaatctagattcatttggttat
atgtgggaatgtccggattactttaacttggatggatatgatatgttgttattttgtcca
caaggtattgatggagaaggtgagcgatttaagaatatctatcaatcagggtatattatg
ggacaatatgacattgataatttaacaatgaatcatggcgacttttttgaacttgaccac
ggctttgatttttatgcgccacaaacgtttatagatgaacatggacagcgagtattaatt
ggctggatgggattgccggaaattaattatccatctgatgttgatggatgggcacactgt
ctaactattccacgtgtactatcgattgaagcaggtaatttaaaacaacgacctgtaaaa
tcccttgaacaattaagaataaataaagaaacagcattagggtatgcgaataaattcacg
agacaattgtatccatatgaaggaagacaatatgaattgattatcgatattttagaaaac
gattcaactgaagtatattttgaagtgcgtacgtctaaaacacaaacaacactgattact
tataataagaaagaacaaaagttaacgttagatcgtagtgaaagtggtttgttaccagac
ccagtcgacaatacaacaagaacaacctatctggatacacctttaacacagttacaatta
tttatcgatacatcgagtgtcgaaatattctgcaacgatggtgaacgtgtcatgacttct
agaatttttacagacgatgaagctacaggcattaaaacatcaacagaatctggacaagta
tatttaaaattcacaaaatatgatttaaaggatgaggaagtatga

DBGET integrated database retrieval system